DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and Y75B8A.6

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:NP_001317789.1 Gene:Y75B8A.6 WormBaseID:WBGene00013543 Length:447 Species:Caenorhabditis elegans

Alignment Length:431 Identity:88/432 (20%)
Similarity:136/432 (31%) Gaps:123/432 (28%)


  Fly    54 HVSGTVSAQPPPPPDAIYNFMSANHKNLDHHHQMNPLLAPPYSGTLPFNSMDLSLQSARSAAQPL 118
            |:...::..||||.      |...|..|.||      :|....|:...||....||:| ||..|:
 Worm     5 HMGAPMNGGPPPPQ------MLQMHHPLPHH------VAVFAHGSSSQNSQAPPLQAA-SATPPV 56

  Fly   119 AKQPPNQQPHQTQQQQQSLIHAPNYPSIQNLTTNATPTST--------------QLQQQQQQEHL 169
            .         .:..:.||....|.  |.:.::::.:.||.              |....|.....
 Worm    57 P---------SSMNRSQSRASCPQ--STREMSSHRSTTSRRCGVCRGCQCKPCGQCTYCQDSPQF 110

  Fly   170 AAMAAAHVSLLQ-------SSRQNQGAPSGNLSNG---------GDCESLLPPPPPTSVSGNTNH 218
            ........|.::       .:|..:.||:.....|         .||:..|......... |.:.
 Worm   111 GGPGVKKQSCIERRCLRVLENRLQRDAPTFKARVGCNACEDCRMQDCQICLVCLDKRFFE-NRHI 174

  Fly   219 TGSNSSSNSGSNNHIAS--PHYMQSRDENFKLTQLKRSFE---PDLSGKNPQKEKDF-------- 270
            .|:..:....:|.....  |..|.....:|.....|||:|   |.:|.:..|::...        
 Worm   175 PGAMCAKKRCNNAQSIECVPSLMSQNPADFVQRAPKRSYELINPVISQQQQQQQSQMHFDVKRVQ 239

  Fly   271 ---GYP---------SASSASKLP---THNVQQQHANKKPSPLRNYHQQQQPPYNLTPKYNGPQT 320
               |.|         .|....::|   |...|.|...::|:...::.|...||.|...:....||
 Worm   240 YMTGPPPQMMQQMQMQAPPQQQIPQPQTPQQQVQQHQQRPNSNSSHSQGPSPPRNGVSQQQQQQT 304

  Fly   321 PPTPQSPLAANPHQMLSPTMDYNQLHLHHQLNSSSGGSYQHMQQDQTQSQSHPQHLHYHNQHATS 385
            ||..|:.:|                   ||:.:..  :.::::|.|.|.|...|.|....|....
 Worm   305 PPQQQNGVA-------------------HQIKTDV--NVENLEQHQQQQQQQQQQLQQQQQRMIF 348

  Fly   386 QTAPPPLL----------PPL---------LTSGQFHAQPQ 407
            |.||.|.|          ||.         |..||....||
 Worm   349 QPAPYPDLSVHARLMVQAPPQVITAPAPIPLPQGQMTHMPQ 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600
Y75B8A.6NP_001317789.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.