DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and RAI1

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_016879514.1 Gene:RAI1 HGNCID:9834 Length:1967 Species:Homo sapiens

Alignment Length:1955 Identity:352/1956 (18%)
Similarity:535/1956 (27%) Gaps:783/1956 (40%)


  Fly     4 NNHPHPGHLSQAAQNASWNPLQIP---------------------SYIPRQPQLAHMSNERPGMV 47
            ::.|:||..:......:|...|.|                     :.:|...|.|....:.|...
Human   104 DSSPYPGRYAGEESLQAWGAPQPPPPQPQPLPAGVAKYDENLMKKTAVPPSRQYAEQGAQVPFRT 168

  Fly    48 RSPLAWHVSGTVSAQPPPPPDAIYNFMSANHKNLDHHHQMNPLLAP---PYSGTLPFNSMDLSLQ 109
            .|   .||.     |||||...:      .:..|......|.:.:|   |.....|.:|......
Human   169 HS---LHVQ-----QPPPPQQPL------AYPKLQRQKLQNDIASPLPFPQGTHFPQHSQSFPTS 219

  Fly   110 SARSAAQPLAKQ---------PPNQQPHQTQQQQQSLIHAPNYPSIQNL----TTNATPTSTQLQ 161
            |..|::.....|         .|..|||.......|.: ||. ..:|||    :...:....|.|
Human   220 STYSSSVQGGGQGAHSYKSCTAPTAQPHDRPLTASSSL-APG-QRVQNLHAYQSGRLSYDQQQQQ 282

  Fly   162 QQQQQEHLAAMAAAHVSLLQSSRQN---------QGAPSGNLSNGGDCESLLPPPPPTSVSGNTN 217
            |||||:...|:.:.|.:......||         ||.        |.|:    |...........
Human   283 QQQQQQQQQALQSRHHAQETLHYQNLAKYQHYGQQGQ--------GYCQ----PDAAVRTPEQYY 335

  Fly   218 HTGSNSSSNSGSNNHIASPHYMQSRD------ENFKLTQLKRSFEPDLSGKNPQKEKDFGY---- 272
            .|.|.|||:|.:.:...||.|..:..      |||..:|     :|..:|..|....|..:    
Human   336 QTFSPSSSHSPARSVGRSPSYSSTPSPLMPNLENFPYSQ-----QPLSTGAFPAGITDHSHFMPL 395

  Fly   273 --PSASSASKLPTHNVQQQHANKKPSPLRNYHQQQQPPYNLTPKYNGPQTPPTPQSPLAANPHQM 335
              ||.:.|    |.:|..|..|.||.      |:.:.|.||....:        ...|.|...|:
Human   396 LNPSPTDA----TSSVDTQAGNCKPL------QKDKLPENLLSDLS--------LQSLTALTSQV 442

  Fly   336 LSPTMDYNQLHLHHQLNSSSGGSYQHMQQDQTQSQSHPQHLHYHNQHATSQTAPPPLL-PPLLTS 399
            .:.:....||.|.........|....:  .:|..|...||........:::.|..||. ||..|.
Human   443 ENISNTVQQLLLSKAAVPQKKGVKNLV--SRTPEQHKSQHCSPEGSGYSAEPAGTPLSEPPSSTP 505

  Fly   400 GQFHAQPQDASQQQTASSSQHQTHHS------RTAQLTNLDQAVKHKPESEEQPVIT---DLSYR 455
            ...||:||:|..   .|.|:.....|      .......::...|.||||.....:|   |:|.:
Human   506 QSTHAEPQEADY---LSGSEDPLERSFLYCNQARGSPARVNSNSKAKPESVSTCSVTSPDDMSTK 567

  Fly   456 NSETDKTAANPVP-----------------------------------------------EAP-- 471
            :.::.::....:|                                               |||  
Human   568 SDDSFQSLHGSLPLDSFSKFVAGERDCPRLLLSALAQEDLASEILGLQEAIGEKADKAWAEAPSL 632

  Fly   472 -----ESPYLTTSNEESLESNSNSSNSRKRRKRKASMVMRVTPNENA------------------ 513
                 :.|:...::...|:|.:.|:..|..........:::....||                  
Human   633 VKDSSKPPFSLENHSACLDSVAKSAWPRPGEPEALPDSLQLDKGGNAKDFSPGLFEDPSVAFATP 697

  Fly   514 -------PEGENSKP------QHPQQAANLNNSCSPKKSPKNGGGEFQPFSTQKQS--------- 556
                   |....:||      ..|..||   ..|.|..:..:......||:..:::         
Human   698 DPKKTTGPLSFGTKPTLGVPAPDPTTAA---FDCFPDTTAASSADSANPFAWPEENLGDACPRWG 759

  Fly   557 --QTENEKTTQENGRGGSPAPAENNSNSNSSTLYNDNENPK------------------TKKQRQ 601
              ..|..|..::.|: .|...::.:::..|:.|....|:|.                  .|::..
Human   760 LHPGELTKGLEQGGK-ASDGISKGDTHEASACLGFQEEDPPGEKVASLPGDFKQEEVGGVKEEAG 823

  Fly   602 ALLQ--------RNLTEQHR-----------------MQQDDEPPKNHTS-----------PAMP 630
            .|||        |.|.:...                 .::|.|..:.::|           |.|.
Human   824 GLLQCPEVAKADRWLEDSRHCCSTADFGDLPLLPPTSRKEDLEAEEEYSSLCELLGSPEQRPGMQ 888

  Fly   631 PP-------------------------SPQSNSSSS--------SSSSSSANTHSSQSSHAVNNI 662
            .|                         ||...|..|        .:.|...:...|..||.....
Human   889 DPLSPKAPLICTKEEVEEVLDSKAGWGSPCHLSGESVILLGPTVGTESKVQSWFESSLSHMKPGE 953

  Fly   663 PKPEINNKATTDTPASPALVEQGDIDAKPAV--------------------SVHECDEEEE---- 703
            ..|: ..:|..|:..|.|.:.|.  ..||||                    .||....|.|    
Human   954 EGPD-GERAPGDSTTSDASLAQK--PNKPAVPEAPIAKKEPVPRGKSLRSRRVHRGLPEAEDSPC 1015

  Fly   704 --PAVNK-----------------------------------------VSPAHPDPPTTAAVAAP 725
              |.:.|                                         ..|..|.||......||
Human  1016 RAPVLPKDLLLPESCTGPPQGQMEGAGAPGRGASEGLPRMCTRSLTALSEPRTPGPPGLTTTPAP 1080

  Fly   726 P-----------------ATESPKKSSPAAN-------SESCPFGEVEDKLEQMFAGIEEETERI 766
            |                 ...|||.:|..:|       |:|.|.|              .:|:..
Human  1081 PDKLGGKQRAAFKSGKRVGKPSPKAASSPSNPAALPVASDSSPMG--------------SKTKET 1131

  Fly   767 SSPEKPAEESAAMVAHNLTAQLALDPSKTLDTPAE-------------NQTSVLAVLAPNQTPTP 818
            .||..|.::..:|:..:.|....:..||. ..|:|             :.:.:.|....:.:|..
Human  1132 DSPSTPGKDQRSMILRSRTKTQEIFHSKR-RRPSEGRLPNCRATKKLLDNSHLPATFKVSSSPQK 1195

  Fly   819 E----------------------IRPVATKAAMKSTMPSPVHSPIPQSRSTSTPLVAGD--DSKS 859
            |                      :..:..|:|..:.:|:...:.:.:|||:|:...:|:  |.|.
Human  1196 EGRVSQRARVPKPGAGSKLSDRPLHALKRKSAFMAPVPTKKRNLVLRSRSSSSSNASGNGGDGKE 1260

  Fly   860 NTP-----------VPAKA--------PAPRRPPPR-------------------------RLSM 880
            ..|           .|.||        ||.:.|||.                         |...
Human  1261 ERPEGSPTLFKRMSSPKKAKPTKGNGEPATKLPPPETPDACLKLASRAAFQGAMKTKVLPPRKGR 1325

  Fly   881 GMDASLLRFMIDDPPAKK-----PGRKKKVTKEPDFEDDDKPSTSAAAAAALAARQLSEAASATK 940
            |:....:...|..|..||     ||........|...|.|:....|..:.......|....:..|
Human  1326 GLKLEAIVQKITSPSLKKFACKAPGASPGNPLSPSLSDKDRGLKGAGGSPVGVEEGLVNVGTGQK 1390

  Fly   941 SKPAAGA-----KKKNAGVKGK--------------------------------------KGSAG 962
             .|.:||     ...|..:|||                                      ||.||
Human  1391 -LPTSGADPLCRNPTNRSLKGKLMNSKKLSSTDCFKTEAFTSPEALQPGGTALAPKKRSRKGRAG 1454

  Fly   963 -----KG--------------------------NAKNAKQNGKK--------------------- 975
                 ||                          :..|:...|||                     
Human  1455 AHGLSKGPLEKRPYLGPALLLTPRDRASGTQGASEDNSGGGGKKPKMEELGLASQPPEGRPCQPQ 1519

  Fly   976 --SARKPAFTT--------------DEDSTPAPTNGGG-------------SVPELRFK------ 1005
              :.::|..|.              .:::|.:|..|..             :.||:|.|      
Human  1520 TRAQKQPGHTNYSSYSKRKRLTRGRAKNTTSSPCKGRAKRRRQQQVLPLDPAEPEIRLKYISSCK 1584

  Fly  1006 -----------SPFILI-KPDGSVSIKNTHSAEDVNEKQTKVKKAPHERKNLRGMHSSTLSNRYD 1058
                       |||:.: |.|...:|...     ||......|  || ||......||:.|:.:.
Human  1585 RLRSDSRTPAFSPFVRVEKRDAFTTICTV-----VNSPGDAPK--PH-RKPSSSASSSSSSSSFS 1641

  Fly  1059 ADT------------------------------------TDSTWICVFCKRGPHKLGLGDLFGPY 1087
            .|.                                    :.|..:|..|:...:...||||.|||
Human  1642 LDAAGASLATLPGGSILQPRPSLPLSSTMHLGPVVSKALSTSCLVCCLCQNPANFKDLGDLCGPY 1706

  Fly  1088 L-----------------VTSDCDEYR------------AAVQTPGAQDIDGMFVNKRRREDMVK 1123
            .                 ....|:|..            ||..|.|          |..|.|.  
Human  1707 YPEHCLPKKKPKLKEKVRPEGTCEEASLPLERTLKGPECAAAATAG----------KPPRPDG-- 1759

  Fly  1124 GQERNLPAVPATLANIMQAP-KISMHKRKRKQTHDSSISYSDDPNESRSQCSSVDLLDCSTESKF 1187
                  ||.||     .|.| :.|.....|:..........:|..|..:........:||.|:  
Human  1760 ------PADPA-----KQGPLRTSARGLSRRLQSCYCCDGREDGGEEAAPADKGRKHECSKEA-- 1811

  Fly  1188 VETFRGMGKTSENGFEV---WLHEDCAVWSNDIHLIGAHVNGLDAAVWDSTRYQCVLCQQTGASI 1249
                     .:|.|.|.   |:||.||||:..::|:...:.||..|:..:....|..||:.||:|
Human  1812 ---------PAEPGGEAQEHWVHEACAVWTGGVYLVAGKLFGLQEAMKVAVDMMCSSCQEAGATI 1867

  Fly  1250 CCFQRCCKAAAHVPCGRSANWSLSEEDRKVYCHLHRHEPGVVEPIKTESIAPVEVSVATPP---A 1311
            .|..:.|....|.||...|                    |...|....::.|::.....||   .
Human  1868 GCCHKGCLHTYHYPCASDA--------------------GTSPPRNRRALEPIQAVQGDPPWAQL 1912

  Fly  1312 PAPPP 1316
            |.|.|
Human  1913 PKPRP 1917

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 57/249 (23%)
RAI1XP_016879514.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112729173
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4715
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14955
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.