DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and si:dkey-94l16.4

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_009304640.1 Gene:si:dkey-94l16.4 ZFINID:ZDB-GENE-121214-291 Length:732 Species:Danio rerio

Alignment Length:790 Identity:158/791 (20%)
Similarity:249/791 (31%) Gaps:242/791 (31%)


  Fly   615 QQDDEPPKNHTSPA--MPPPSPQSNSSSSSSSSSSANTHSSQSSHAVNNIPKPEINNKATTDTPA 677
            :.|.||    |.||  :.|....||::.:.|..|.::..|..|  .|..:|...:.     ...|
Zfish    59 ESDSEP----TIPAGQIQPDEAFSNTTVTLSYVSRSHLFSEHS--PVYGVPSAFLR-----AYDA 112

  Fly   678 SPALVEQGDIDAKPAVSV----HECDE-----EEEPAVNKVSPAHPDPPTTAAVAAPPATESPKK 733
            .....:.||:|....|||    ..|::     .|:...|..:..:...|....:    |.|:.| 
Zfish   113 GKLAADAGDVDCVQQVSVPLGLTTCEQLGFLTPEQVVENMAALCYLQQPDVENL----ALETLK- 172

  Fly   734 SSPAANSESCPFGEVEDKLEQMFA-----------GIEEE----TERISSPEKP--------AEE 775
             |..||...|.|....|:|:...|           |..||    .|.:.....|        :||
Zfish   173 -SLQANPGECRFPISVDELQNGAANGLWSVNPFQGGFPEENGGDVEGLHPNVNPELVLLISRSEE 236

  Fly   776 SAAMVAHNLTAQLALDPS--KTLDT--PAENQTSVLAVLAPNQTPTPEIRPVATKAAMKSTMPSP 836
            ...:.....:..|:|:|.  ..||:  |:|.||...:  |.|.||...:...|.:......|.| 
Zfish   237 PLILPNEATSFALSLNPEFVSPLDSALPSEEQTQDDS--AQNATPPSGLMNDAMQKEAIEVMNS- 298

  Fly   837 VHSPIPQSRSTSTPLVAGDDSKSNTPVPAKAPAPRRPPPRRLSMGM-------DASLLRF----M 890
             .|.:..::.|.........:..:..:..|....|:..|.|...||       :..|.|.    :
Zfish   299 -SSCVKLTKQTENDASDAFKTSDDLVIKTKKIPERKTLPPRAGRGMRLEAIVQNMQLFRCKSTRV 362

  Fly   891 IDDPPAKKPGRKK-------------KVTKEP-DFEDDDKP----STSAAAAAALAARQLS---- 933
            :......||.|.|             .|..|| :.....:.    |||......|...:..    
Zfish   363 VKPRGTNKPSRVKTHNSVLAEKTEVQHVHTEPTEVRRSSRRKATISTSTPVKTFLKCTKNESTNR 427

  Fly   934 EAASATKSKPAAGAKKKNAGVKGKKGSAGKGNAKNAKQNGKKSARKPAFTTDEDSTPAPTNGGGS 998
            ..:|.|.::......|.|..:|           |:.|:..||....|.|:..|            
Zfish   428 NCSSLTSNQGNQAVHKHNVSIK-----------KSVKRKNKKCKSTPFFSAQE------------ 469

  Fly   999 VPELRFK--------------SPFILIKPDGSVSIKNTHSAEDVNEKQTKVKKA----------- 1038
             ||:..|              :|::      .|...|.......|||:.|.|.:           
Zfish   470 -PEINLKCLKLKKKEVRDDSFAPYV------RVQFSNCTIVNYPNEKRGKSKTSAGFLSGITPAT 527

  Fly  1039 ---PHERKNLRGMHSSTLSNRYDADTTDSTWICVFCKRGPHKLGLGDLFGPYLVTSDCDEYRAAV 1100
               .|.|.::.|.|...|             :|..|....:.:.||||.|||..           
Zfish   528 PGFQHGRVSMDGEHQDLL-------------VCCLCGSSSNAMDLGDLHGPYYA----------- 568

  Fly  1101 QTPGAQDIDGMFVNKRRREDMVKGQERNLPAVPATLANIMQAPKI-SMHKRKRKQTHDSSISYSD 1164
                                                .....|.|: |.|:.......|||..   
Zfish   569 ------------------------------------EGFKPASKVASNHQEDENSDSDSSFR--- 594

  Fly  1165 DPNESRSQCSSVDLLDCSTESKFVETFRGMGKTSE------------------NGFEVWLHEDCA 1211
              .::.::.:..|.||.        .:.|:|:.:.                  :..|.|.|||||
Zfish   595 --GKTAAEGNWTDSLDW--------RWSGVGEPARRVRTDSPIDWYSPPVVPLHETEHWFHEDCA 649

  Fly  1212 VWSNDIHLIGAHVNGLDAAVWDSTRYQCVLCQQTGASICCFQRCCKAAAHVPCGRSANWSLSEED 1276
            :||..:.|:...:.||:.||..:....|..||:|||::.|..:.|....|..|...:...|:|::
Zfish   650 IWSAGVFLVRGKLYGLENAVKLAKVSVCSTCQRTGATLGCVYKGCLNKYHYTCAVQSGCVLNEDN 714

  Fly  1277 RKVYCHLHRH 1286
            ..:.|..|::
Zfish   715 YSMKCRKHKN 724

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 48/235 (20%)
si:dkey-94l16.4XP_009304640.1 ePHD_RAI1_like 547..722 CDD:277138 48/235 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112726371
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003562
OrthoInspector 1 1.000 T596716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14955
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.