DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and rai1

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_005171718.2 Gene:rai1 ID: Length:1935 Species:Danio rerio

Alignment Length:1395 Identity:267/1396 (19%)
Similarity:467/1396 (33%) Gaps:407/1396 (29%)


  Fly   131 QQQQQSLIHAPNYPSIQNLTTNATPTSTQLQQQQQQEHLAAMAAAHVSLLQSSRQNQGAPSGNLS 195
            :.:.|:.:..|...|..|       ::|:|...:::||            .||..:...|:..|.
Zfish   706 KSEPQTSVEMPTEDSPSN-------SATELCLPEKEEH------------SSSENSVETPTCTLE 751

  Fly   196 NGGDCESLLPPPPPTSVSGNTNH----------TGSNSSSNSGSNNHIASPHYMQSRDENFKLTQ 250
              |..::|   ...|||..:|:.          |.|....|:.:.:..:.|....:.:|...:.|
Zfish   752 --GPADTL---EEQTSVLSHTSTEVGDEKDSILTSSEEVINNKTESQESFPDVCGTYEEAENMQQ 811

  Fly   251 LKRSFEPDLSGKNPQKEKDFGYPSASSASKLPTHNVQQQHA--NKKPSPL---RNYHQQQQPPYN 310
            :.......::...|.::.:........|.:  ||..:...:  |:|.:||   |::|........
Zfish   812 VNTETAESIAQDTPHRDSERRSVICDIAPQ--THTAKSDFSALNEKTTPLAQARDHHIDCSDAKV 874

  Fly   311 LTPKYNGPQ---------------TPPTPQS-----------PLAANPH---QMLSP---TMDYN 343
            |.|  :.||               |||:|:.           |.|..|.   :..:|   |..:.
Zfish   875 LEP--DSPQLPGKSILHSAPSWADTPPSPKKADEDMEPGISCPSAVTPSAKPEAFTPSSHTRMFG 937

  Fly   344 QLHL---HHQLNSSSGGSYQHMQQDQTQSQSHP--------QHLHYHNQHATSQTAPPPL----L 393
            :.|:   ...::|::|...|...:..||:.:.|        ..:...:|:.:|||  |.|    |
Zfish   938 KKHVRGRRRPMSSTAGIRRQLSIEGDTQTPNIPSSKTTDIVDQMETAHQNVSSQT--PKLVTESL 1000

  Fly   394 PPLLTSGQFHAQ------PQDASQQQTASSSQHQTHHS-RTAQLTNLDQAVKHKPE--------- 442
            |..:.:..:.:|      |||..:.....:.:..:..: :....:|...|.||.|:         
Zfish  1001 PSRMCTRSYGSQGSPKVSPQDRRKPGAKPAPKPSSKIAVKPGPKSNPKPAPKHSPKSITKPGSKS 1065

  Fly   443 ----------------------SEEQPVITDLSYRNSET---DKTAANPVPE---------APES 473
                                  |:|.|.....|...|.|   .|||:.|..:         ||:|
Zfish  1066 VPKSEVMPSVKPGPKPGLKSTGSKESPKPCPKSGPKSATKSGPKTASKPASKPGSVPGEILAPKS 1130

  Fly   474 PYLTTSNEESLESNSNSSNSRKRRKRKASMVMRVTPNENAPEGENSKPQHPQQAANLNN------ 532
            ...|..::.::.|.:......|...:...|.|:...|..... |::|..|..|..||.:      
Zfish  1131 NQNTAESKPTVASVAKGPGRPKGISKNKQMKMKQDENVQTTT-EHTKDTHCTQELNLQDVTTELA 1194

  Fly   533 --------------------SCSPKKS-PKNGGGEFQPFSTQKQSQTENEKTTQENGRGGSPAPA 576
                                .|:...| .|:.|.|.:....:.:.||: ||.|:|.         
Zfish  1195 LDTIVGVVDTTKGETVAPTLECTLDSSCLKSLGREQKSMVLRSRKQTK-EKLTEEK--------- 1249

  Fly   577 ENNSNSNSST----LYND---NENPKTKKQRQAL-LQRNLTEQHRMQQDDEPPKNHTSPAMPPPS 633
            |.|.:.::.|    :..|   :::.||:.....| .|::::.....|.|:|........::|   
Zfish  1250 EQNDDKSTKTPLAMVMQDVTVDQSCKTEPSNLELPKQKDVSTDSLQQPDEEVVSTKRKCSLP--- 1311

  Fly   634 PQSNSSSSSSSSSSANTHSSQSSHAVNNIPK-----------PEINNKATTDTPASPALVEQGDI 687
              ::.:............:..|...:.:|||           ..::...||||      :...||
Zfish  1312 --TSETKKRKKGRQDEVKAQDSPLDIVHIPKGKRKRGQRLLVESVSTTLTTDT------LPTDDI 1368

  Fly   688 DAKPAVSVHECDEEEEPAVNKVSPAHPDPPTTAAVAAPPATESPKKSSPAANSESCPFGEVEDKL 752
            ...|:|. .:|     |...|..|................|....|..|.:|....   .:|:..
Zfish  1369 SDVPSVP-PQC-----PTKTKYLPPRKGRGLKYEAMVQKITSPGSKKQPVSNQADI---ALEEST 1424

  Fly   753 EQMFAGIEEETERISSPEKPAEESAAMVAHNLTAQLALDPSKT-LDTPAENQTSVLAVLAPNQTP 816
            .:....:.::.|..::||.|.:|..:.::       ..:|..| :.||.:.:.. .|.:..:..|
Zfish  1425 LKPVPQVPDQKETTNAPEMPQKEGESTIS-------TQEPENTEIQTPRKKRRK-WATVESSDAP 1481

  Fly   817 ------------TPEIRPVATKAAMKSTMPSPVHSPIPQSRSTST------PLVAGDDSKSNTPV 863
                        ||.:   |.:.|:|:.  ..:|....:.|...|      |:|...:|.....:
Zfish  1482 DVSLDGGSLIINTPRL---AKQRAIKNN--HEMHLKQRKKRRKGTEPQENIPIVEQPESTQTEVL 1541

  Fly   864 PAKAPAPR-------RPPPRRLSMGMDASLLRFMIDDPPAKKP--GRKKKVTKEPDFEDDDKPST 919
            |...|.|.       :.||..:.:              |..||  ||:..:.|:.:         
Zfish  1542 PTSPPPPEALEQTECKEPPNEVCV--------------PLMKPKRGRRPSLKKKQE--------- 1583

  Fly   920 SAAAAAALAARQLSEAASATKSKPAAGAKKKNAGVKGKKGSAGKGNAKNAKQNGKKSARKPAFTT 984
                          |.:.:.|....|..|||..|.|.|...|.|...|           :|...|
Zfish  1584 --------------ELSKSQKEDENAIEKKKKTGPKKKCVDAVKVVVK-----------RPKIKT 1623

  Fly   985 DEDSTPAPTNGGGSVPELR---------FKSPFILIKPDGSVSIKNT-----HSAEDVNEKQTKV 1035
            :|.|   || ..|::.:||         |: |::.|  |.|:.:.::     ...|:....|.:.
Zfish  1624 NELS---PT-VQGTLSDLRPDLSDGKSSFR-PYVHI--DSSMDVASSCTIVNRPEEEQMLAQART 1681

  Fly  1036 KKAPHERKNLRGMHSSTLSNR--------YDADTTDSTWICVFCKRGPHKLGLGDLFGPYLVTSD 1092
            |..|    |::...:.|.||.        .:...:|....|..|.:..:...||||.||| ...|
Zfish  1682 KSVP----NIKNQAAKTGSNSSVMLQGPLVNKSLSDRCLTCCLCGKPANYRELGDLCGPY-YPED 1741

  Fly  1093 C-----------DEYR----AAVQTPGAQDI-----------------DGMFVNKRRREDMVKGQ 1125
            |           .|:|    .|.:|..:..:                 :|   :.||.:..::..
Zfish  1742 CIPRKTLSLTHRSEFRQNSNCANETESSSIVKNTQSVCEEAIHQEKANEG---HSRRSKRAIREL 1803

  Fly  1126 ERNLPAVPATLANIMQAPKISMHKRKRKQTHDSSISYSDDPNESRSQCSSVDLLDCSTESKFVET 1190
            .|..|:              |..:.||.....|.:|.:..|.......:|:..|....|.|    
Zfish  1804 SRTRPS--------------SRMRFKRLLILQSRLSGASPPAGVEGIETSLQRLQMEAEEK---- 1850

  Fly  1191 FRGMGKTSENGFEVWLHEDCAVWSNDIHLIGAHVNGLDAAVWDSTRYQCVLCQQTGASICCFQRC 1255
                        |.|.||.||||:..|.|:...:.||..||..:...:|..||..|||:||..:.
Zfish  1851 ------------EHWAHEACAVWTTGIVLVADKLFGLTEAVQKAAHAKCSGCQGEGASVCCGWKS 1903

  Fly  1256 CKAAAHVPCGRSANWSLSEEDRKVYCHLHR 1285
            |..:.|..|.:.:..:..||...:.|..|:
Zfish  1904 CTQSYHYICAKESGCTFEEETFSIRCPKHK 1933

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 58/248 (23%)
rai1XP_005171718.2 PHD_SF 1718..1932 CDD:304600 58/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112726392
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T596716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14955
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.