DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and si:ch211-57f7.7

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_021336444.1 Gene:si:ch211-57f7.7 ZFINID:ZDB-GENE-090313-119 Length:382 Species:Danio rerio

Alignment Length:220 Identity:51/221 (23%)
Similarity:81/221 (37%) Gaps:66/221 (30%)


  Fly   572 SPAPAENNSNSNSSTLYNDNENPKTKKQRQALLQRNLTEQHRMQQDDEPPKNHTSPAMPPPS--- 633
            ||..|   |:.|.:|.:||..:  |:......:|.:...|.........|...:|...|..|   
Zfish    76 SPGTA---SDENMNTDFNDQSS--TQNSSSTRVQSSTRTQFSTSFSSAQPSTSSSDTQPFTSFSG 135

  Fly   634 --PQSNSSSSSSSSSSANTHSSQSSHAVNNIPKPEINNK----ATTDTPASPALVEQ-------- 684
              |.::|||...|:||:.|.:|.||   :::| |..|::    :|..:.|.|:...|        
Zfish   136 VQPFTSSSSVLPSTSSSGTQASTSS---SSLP-PSTNSRGLQPSTLSSGAQPSTSGQLCTRRNAP 196

  Fly   685 ----------------GDIDAKPAVSVHECDEEEEPAVNKVSPAHPDPPTTAAVAA-------PP 726
                            ||.|...::.....::|||           |.....|:.|       ||
Zfish   197 AQSWNTDQSFRSASWDGDYDTYISLLRGTSEDEEE-----------DEDLCCAIMASIEDQIFPP 250

  Fly   727 ATESPKK------SSPAANSESCPF 745
            |.|.|.|      :|....:::|.|
Zfish   251 AVEIPIKEILEELASKINGNQTCKF 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600
si:ch211-57f7.7XP_021336444.1 HECTc 273..>344 CDD:331829 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.