DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and rai1

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_004918129.1 Gene:rai1 XenbaseID:XB-GENE-987626 Length:1820 Species:Xenopus tropicalis

Alignment Length:1696 Identity:315/1697 (19%)
Similarity:530/1697 (31%) Gaps:562/1697 (33%)


  Fly    11 HLSQAAQNASWNPLQIPSYIPRQ------PQLAHMSNERPGMVRSPLAWHVSGTVSAQPPPPPDA 69
            |.||  ||.::...:.||..|.|      |..:|......|  |||       :.|:.|.|....
 Frog   262 HYSQ--QNQTYCQSETPSRTPEQYYQPFSPSASHSPARSVG--RSP-------SYSSTPSPLMPN 315

  Fly    70 IYNF------MSANHKN-------LDHHHQMNPLLAPPYSGTLPFNSM---------------DL 106
            :.||      ....|..       .||.|.| |||.|..:||....|.               ||
 Frog   316 LENFQYNQQQQQQQHNTGTFPLSMTDHSHYM-PLLNPSPTGTSSPESQSKSLQNDKIPETLLSDL 379

  Fly   107 SLQSARSAAQPLAKQPPNQQPHQTQQQQQSLIHAPNYPSIQNLTTNATPTSTQLQQQQQQEHLAA 171
            ||||..:..        :|..:.:...||.|:.....|.     .....||.:..:|.:.:|.:.
 Frog   380 SLQSLTALT--------SQVENISNTVQQLLLSKSGVPQ-----KKVMKTSPRTPEQIKGQHCSP 431

  Fly   172 MAAAHVSLLQSSRQNQGAPSGNLSNG-GDCESLLPPPPPTS-VSGNTNHTGSN------SSSNSG 228
            .:..:      |.:..|.|   ||:. |..:|:....|.|. :||:.:....|      ..|.:.
 Frog   432 ESNTY------SAEQIGTP---LSDALGTPQSVHTEIPDTDYLSGSEDQLERNYLYCGPGQSPAR 487

  Fly   229 SNN-----------HIASPHYMQSR-DENFKLTQLKRSFEPDLSGKNPQKEKDFGYPSASSASKL 281
            :||           .:.||..|.:: |::|:..|.....|......:.::|......:|.|..:|
 Frog   488 ANNPKMKPESLSTCSVTSPDNMSTKSDDSFQSIQASLPLETFAKLVSSERECPHLLVNALSQEEL 552

  Fly   282 PTHNVQQQ--------------------HANKKPSPLRN-------------------------- 300
            .|..:..|                    |:.|.|..|.|                          
 Frog   553 STEIIALQDAIDNEKAEKAWVDSPVLSNHSPKSPLHLENSSACVETAIQTWSGQENVEEFPEDLK 617

  Fly   301 -------------------YHQQQQPP-----------------------------YNLTPKYNG 317
                               :.:::.||                             |..:...:.
 Frog   618 KSMTEEAKPNQDSCYSDKSFEREEMPPEPTEATKTIDNSGSLCSDKNILAATSSASYTSSSDTSA 682

  Fly   318 PQTPPTPQSPLAANPHQMLSPTMDYN--QLHLH-------------------------------- 348
            ..|.|....|.......|....:.:.  :|.||                                
 Frog   683 STTCPKTMDPFGWPDKNMTESCLRWKDLELSLHESDLEKDLFQVKDNKIDCQLDVPDVETPLEND 747

  Fly   349 --HQLNSSSGGSYQHMQQDQTQSQSHPQHLH--YHNQHATSQTAPPPLLPPLLTSGQFHAQPQDA 409
              .:.|....|...:....:|.::...:...  |..:....       :|.:.:..:.:.:|:|.
 Frog   748 SGEEFNKEGAGDLAYTDIGKTDNEKWLEDTRDCYTEEDFQD-------IPDIPSQKESNLEPEDY 805

  Fly   410 SQ--------------------------------QQTASSSQHQTHHSRTAQLTN---------- 432
            |.                                :...:.|..:..:|..:||:.          
 Frog   806 SSLCDFSDRKSFIYDTSPSKPLKDMEMVSSINTPESVENPSLEEKENSAPSQLSGHSIILLGPAV 870

  Fly   433 ---------LDQAVKH-------KPESEE-------QPV------ITDLSYRNSETDKTAANPVP 468
                     .:..:.|       |.::||       :|:      :.||..::::.|..|..|:.
 Frog   871 ATESKVKSWFESTITHIKTVGDIKEKNEEDAEACALEPLTLPDRDMKDLKVQDNQLDVKAEEPLE 935

  Fly   469 EAP----ESPYLTTSNEESLESNSNSSN--------SRKRRKRKASMVMRVTPNENAPEGENSKP 521
            ..|    ::|....   |::|||..:.|        ..::.:..|:..|.:.|...||..| :||
 Frog   936 RKPLRSKKNPCRAV---EAVESNKVAQNPVGETAKADNEKAQEGAANTMVIVPVAKAPVAE-AKP 996

  Fly   522 QHPQQAANLNNSCSPKKSPKNGGGEFQP-----FSTQKQSQ-TENEKTTQENGRGGSPA------ 574
                 |.....|.:.|..|:..||...|     ..|.|:.: :..|:|:.:.||.|..|      
 Frog   997 -----ARMCTRSSTAKADPQVNGGAVGPPPLHQEKTNKKGEFSVKERTSFKPGRRGGKAVMKLVS 1056

  Fly   575 -------PAENNSNSN-SSTLYNDNENPKTKKQRQALLQRNLTEQHRMQQDDEPPKNHTSPAMPP 631
                   ..::.|.|. .|....:|.....|.::..:|:....:|...|......|...|..:  
 Frog  1057 SCDRKNFMLQSKSQSKLGSQKAKENSIKLLKDEKSMILRSRSKKQELFQTKKRKGKRGMSVVI-- 1119

  Fly   632 PSPQSNSSSSSSSSSSANTHSSQSSHAVNNIPKPEINNKATTDTPASPALVEQ---------GDI 687
                  ...:......||..:...::.:  |||.:....|....|.:..:.::         ..|
 Frog  1120 ------KKRACLKKILANNCTVPDTYKL--IPKVKRMKLANAGVPINAKVSDRCLHSLKRKANFI 1176

  Fly   688 DAKPAV-------SVHECDEEEEPA---VNKVSPAHPD--------PPTTAAVAAPPATESPKKS 734
            ...||.       |.:..:|:.||.   ..|:.|...:        ..|...:...||.....:.
 Frog  1177 SPVPAKKKNLILRSKNVKEEKSEPTPHLFKKIRPTKKEKVKLTIAAKKTCKVILKTPAVRVTPEV 1241

  Fly   735 SPAANSESCPFGEVEDKLEQMFAG----IEEETERISSPEKPAEESAAMVAHNLTAQLALDPSKT 795
            .....|.|...|.|:.|:.....|    :|...::|:||.:..:.......:|..|  |.|.|..
 Frog  1242 RIKVPSRSSYAGAVKTKVLPPRKGRGLKLEAIVQKITSPNQKKQGIPGACFYNSVA--AGDNSLN 1304

  Fly   796 LDTPAENQTSVLAVLAPNQTPT----------PEIRPVATKAA-MKSTMPSPVHS-PIPQSRSTS 848
            ..||.:....:..|.|.::|.|          |::..::.:.: .:|....|:|| .:..|....
 Frog  1305 ALTPGKELRELSLVSADSETRTVSQNNALTSEPDLHSLSCRGSNNRSLKGKPLHSKKLTSSSLHC 1369

  Fly   849 TPLVAGDDSKSNTPVPAKAPAPRRPPPRRLSMGMDASLLRFMIDDPPAKKPGRKKKVTKEPDFED 913
            |....|.:.:.:.   .||......|.||:                   :.||.|.....|  ::
 Frog  1370 TTTHRGTEQEGSY---IKAKRLSTVPKRRI-------------------RRGRSKGAVDRP--KN 1410

  Fly   914 DDKPSTSAAAAAALAARQ--LSEAASAT--------KSKPA--AGAKKKNAGVKGKKGSAGKGNA 966
            ..|....|:.:|.|.:|.  |||:...|        |..|:  :|.::.::.|:.:|      ..
 Frog  1411 TSKRQIGASPSALLTSRDKALSESVHQTNKCKKPELKEAPSVPSGVEESSSQVRARK------KT 1469

  Fly   967 KNAKQNG-----KKSA--RKPA-------FTTDEDSTP--APTNGGGSVPELRFKSPFILIKPDG 1015
            |.|..||     :|.|  .|||       .|....|.|  :|..     ||::.|  ::..||..
 Frog  1470 KYASFNGYTKRQRKCAPRNKPAKQTTGRKCTARRKSVPLVSPKE-----PEIKLK--YVSNKPMR 1527

  Fly  1016 SVSIKNTHS----AEDVNEKQTK---VKKAPHERKNLRG---MHSSTLSNRYDADTT-------- 1062
            |.|.....|    .|:.||..|.   :..|..|.:.|:.   |||...|..:.:..|        
 Frog  1528 SESRVRPFSPYIQVENKNEYTTTCTVINTAVEENRLLKERSIMHSVPHSASFASSGTLPLSSRMQ 1592

  Fly  1063 ----------DSTWICVFCKRGPHKLGLGDLFGPYLVTSDCDEYRAAVQTPGAQDIDGMFVNKRR 1117
                      ....:|..|:...:...||||.|||                  ..:|.:...|.|
 Frog  1593 LGPLVCKAVPSGCLVCCLCRNPANFKDLGDLCGPY------------------YPMDSLPNKKGR 1639

  Fly  1118 REDMVKGQERNLPAVPATLANIMQAPKISMHKRKRKQTHDSSISYSDDPNESRSQCSSVDLLDCS 1182
            .:|..:               |.:||     ..|..:..||..:.    ...|:.||.|..||.|
 Frog  1640 PKDKFR---------------IAEAP-----AEKAAKVSDSVCTV----GSGRAPCSDVGELDPS 1680

  Fly  1183 TESKFVETFRGM----------GKTSE-----------------------NGFEVWLHEDCAVWS 1214
            ..:....:.|||          .||.|                       ...|.|:||.||||:
 Frog  1681 KHNNLRTSARGMLRKLPSCYCCSKTVEIAETEKPRRHQCNKALEPPTPELETQEHWVHEACAVWT 1745

  Fly  1215 NDIHLIGAHVNGLDAAVWDSTRYQCVLCQQTGASICCFQRCCKAAAHVPCGRSANWSLSEEDRKV 1279
            :.::|:...:.|::.|:..:....|..||:.||::.|..:.|:.:.|:.|...|...||||:..:
 Frog  1746 SGVYLVAGKLYGINEAIQMAAAGLCPKCQRPGATVGCSHKGCEQSYHITCAVEAGCLLSEENFSL 1810

  Fly  1280 YCHLHR 1285
            .|..|:
 Frog  1811 RCPKHK 1816

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 58/249 (23%)
rai1XP_004918129.1 ePHD_RAI1 1608..1815 CDD:277170 58/249 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112728726
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.