DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and Setdb2

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_002725155.1 Gene:Setdb2 RGDID:2319564 Length:1008 Species:Rattus norvegicus

Alignment Length:1070 Identity:187/1071 (17%)
Similarity:317/1071 (30%) Gaps:413/1071 (39%)


  Fly   430 LTNLDQAVKHKPES-----EEQPVITDLSYRNSETDKTAANPVPEAPESPYLTTSNEESLESNSN 489
            |.:|.|.:|....:     :...::.:.:..||:|.:....||          |.||:..:||..
  Rat    32 LHSLKQKIKDGSATNGDYVQAMVLVNEATLSNSQTLEKDHTPV----------TQNEQKNKSNVF 86

  Fly   490 SSNSRKRRKRKASMVMRV-----TPNENAPEGENSKPQHPQQAANLNNSCSP---KKSPKNGGGE 546
            .|.|.:....:..:::..     .|..|..||...| :.|..|:..::.||.   :::|.:..||
  Rat    87 PSTSCENPSPEDCIILSTGRKGFLPVNNKTEGSGEK-EPPLHASFHHHVCSSACLREAPLSLKGE 150

  Fly   547 FQPFSTQKQS--QTENEKTTQENGRGGSPAPAENNSNSNSSTLYNDNENPKTKKQRQA------L 603
             .|.....:.  |..:.||                 ||.|:.|:.:...|..:..|..      |
  Rat   151 -NPLQLPLRCHFQRRHAKT-----------------NSPSAALHVNYRTPCGRSLRNMEEVFHYL 197

  Fly   604 LQRNLTEQHRMQQDD-------EPPKNHTSPAMPPPSPQSNS-SSSSSSSSSANTHSSQSSHAVN 660
            |:   ||.:.:..|:       :..:||         |:.|. .|....|:...:.|....:.|:
  Rat   198 LE---TECNFLFTDNFSFNTYVQLTRNH---------PKQNEVVSDVDISNGVESVSISFCNEVD 250

  Fly   661 NIPKPEINNKATTDTPASPAL-----------VEQGDIDAKPAVSVHECDEEEEPAVN-KVSPAH 713
            |...|:...: ||..|.:..|           ..:|.||.|      :|...:..|.| |..|..
  Rat   251 NSKLPQFKYR-TTVWPRAYHLNVSSMFSDSCDCSEGCIDIK------KCACLQLTAKNAKACPLS 308

  Fly   714 PDPPTTAAVAAPPATESPKKSSPA----------ANSESCPFGEVED---------KLEQMFAGI 759
            ||...|..     ..:..::..|:          .|.:.|....::.         |.|:...|:
  Rat   309 PDGECTGY-----KYKRLQRLIPSGIYECNLFCKCNRQMCQNRVIQHGPRVRLQVFKSEKKGWGV 368

  Fly   760 E--EETER-------------ISSPEKP-AEESAAMVAHNLTAQLALDPSKTLDTPAENQTSVLA 808
            .  ::.::             .::|||. ..||.:...|            |:......:..:..
  Rat   369 RCLDDIDKGTFVCIYSGRLLSRATPEKTNIGESESEQQH------------TVKNSFSKKRKIEV 421

  Fly   809 VLAPNQTPTPEIRPVATKAAMKSTMPSPV-------------HSPIPQSRSTSTPLVAGDDSKSN 860
            |.:..||.....:.........|.:..||             ||.|.:.:|.:.  |...:.|:.
  Rat   422 VCSDRQTHCESPKTEGCPPKFSSDLEEPVVEMNNRNISRTQRHSVIRRPKSKTD--VFHYNEKNM 484

  Fly   861 TPVPAKAPAPRRPPPRRLSMGMDASLLRFMIDDPPAKKPGRKKKVTKEPDFEDDDKPSTSAAAAA 925
            ..|.:.:.||                     ::....||.::...:|.....:|    .|::...
  Rat   485 GFVCSYSAAP---------------------EEKNGFKPAQEHLDSKARRAHED----LSSSQVG 524

  Fly   926 ALAARQLSEA------ASATKSKPAAGAKKKNAGVKGKKGSAGKGNAKNAKQNGKKSARKPAFTT 984
            ....:||:|:      .|...:.||.|.  |:|.:...|             |.||....|..|:
  Rat   525 YSEDKQLTESDVIDTTTSREDTSPAYGC--KHAAILNSK-------------NTKKVLEVPVKTS 574

  Fly   985 DEDSTPAPTNG-----------------GGSVPELRFKSPFIL-IKPDGSVSIKNTHSAEDVNEK 1031
            .|:. ||.:..                 ..|:.:|..:|.|:| ...:|:|.....||... |..
  Rat   575 QEEE-PAASQSQQVSCGEELASERTKIPSASLVQLSKESLFLLDASKEGNVGRFLNHSCYP-NLW 637

  Fly  1032 QTKVKKAPHERKNLRGMHSSTLSNRYDADTTDSTW--------------IC-VFCKRGPHKLGLG 1081
            ...|....|:|   ....::..:|||....|:.||              :| .||:         
  Rat   638 VQNVFVETHDR---NFPLAAFFTNRYVKARTELTWDYGYEAGTMPEKEILCQCFCQ--------- 690

  Fly  1082 DLFGPYLVTSDCDEYRAAVQTPGAQDIDGMFVNKRRREDMVKGQERNLPAVPATLANIMQAPKIS 1146
                   ||... |.|..|..|                                           
  Rat   691 -------VTEKM-EKRTCVLCP------------------------------------------- 704

  Fly  1147 MHKRKRKQTHDSSISY-SDDPNESRSQCSSVDLLDCSTESKFVETFRGMGKTSENGFEVWLHEDC 1210
                   :.||.|:.| |...|                                    :..||:|
  Rat   705 -------EGHDWSVIYFSPSAN------------------------------------IAAHENC 726

  Fly  1211 AVWSNDIHLIGAH----------VNGLDAAVWDSTRYQCVLCQQTGASICCFQRCCKAAAHVPCG 1265
            .::|:.:....||          |:.:...:|:.:..:|..|...||.:.|.:..|....|:.| 
  Rat   727 LLYSSGLVECEAHDPFNIAKNFDVSSVLEKIWNGSTSKCSFCNNEGAIMGCDETSCAKNYHLLC- 790

  Fly  1266 RSANWSLSEEDR-----------KVYCHLHRHEPGVVEPI---------------KTESIAPVEV 1304
                   ::|||           |::|  ..|.|...|..               |..|:.|   
  Rat   791 -------AKEDRAILQVGVKRTYKIFC--PEHPPQQEETTERANGLSIKKRRGRKKRRSLGP--- 843

  Fly  1305 SVATPPAPAPPPAFNIHSLPXVRVRVQKCR 1334
                   ||.|             :..|||
  Rat   844 -------PAQP-------------KTMKCR 853

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 36/239 (15%)
Setdb2XP_002725155.1 HMT_MBD 152..212 CDD:238689 15/80 (19%)
Pre-SET 234..346 CDD:282838 24/124 (19%)
SET 354..>395 CDD:214614 5/41 (12%)
SET <612..674 CDD:214614 17/66 (26%)
PHD_SF 700..813 CDD:304600 29/209 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.