DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and kmt2b

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_002940678.2 Gene:kmt2b XenbaseID:XB-GENE-853845 Length:2817 Species:Xenopus tropicalis

Alignment Length:1479 Identity:289/1480 (20%)
Similarity:465/1480 (31%) Gaps:550/1480 (37%)


  Fly   170 AAMAAAHVSLLQSSRQNQG-----APSGNLSNGGDCESLLPPPPPTSVSGNTNHTGSNSSSNSGS 229
            |..:|...||..:.|.|:|     ||:.:|      .|..||..|.             .|...|
 Frog    89 AEESALGSSLRLALRSNRGKTPDPAPTSSL------PSAAPPRKPL-------------CSIPPS 134

  Fly   230 NNHIASPHYMQSRDENFKLTQLKRSFEPDLSG--------KNPQKEK-DFGY--------PSASS 277
            ..||.:|    .::....||||    :|.|..        ..|:||: ..|.        ||..:
 Frog   135 LRHIFTP----EKEVRVHLTQL----DPSLFNMAKYSTIITRPKKEEVPIGLERQNSPADPSTGA 191

  Fly   278 ASKLPTHNVQQQHANKKPSPLRNYHQQQQPPYNLTPKYNGPQTPPTPQSPLAANPHQMLSPTMDY 342
            ..||.|....:|....:.:.:|.:..:....:.     :..||.       .::|.|..:...| 
 Frog   192 EHKLYTAEPPKQKGRPQRARVRTWKARASEAFR-----HHSQTD-------HSDPSQEETKCCD- 243

  Fly   343 NQLHLHHQLNSSSGGSYQHMQQDQTQSQSHPQHLHYHNQHATSQTAPPPLLPPLLTSGQFHAQPQ 407
                   :.|::..........|:|..|   :.|:...:..|||...|..|...|...:.||...
 Frog   244 -------EGNATDNCDAPSAATDKTDEQ---EELNDRKRTLTSQVIAPSELEGTLCRREGHASNA 298

  Fly   408 DASQQQTASSSQHQTHHSRTAQLTNLDQAVK------HKPESEEQPVITDLSYRNSETDKTAAN- 465
            ...::...:|........|..|.......||      :|.|:|       |....||.|.||.: 
 Frog   299 QVLEKDLPASPNKACPAFREGQGDTQVPRVKWKLWADYKQENE-------LETGASEADVTANDT 356

  Fly   466 --------PVPE------------------APESPYLTTSNEESLESNSNSSNSRKRRKRKASM- 503
                    |:||                  .||:..|..|.....|..:.|.......:.||.: 
 Frog   357 AYGGNMDLPLPEEGLQSKEALPSGPTDRLLCPEAEGLQASECLEREERNQSDGCGTGEEHKADID 421

  Fly   504 ----------------------------VMRV-TPNENA-----------PEGENSKPQHPQQAA 528
                                        |:.| :.||||           |: .:|.|:: ::..
 Frog   422 CGSEGLLLPHHEDSSGFPASVLAAEETSVLDVNSTNENAGFILAAEPPALPD-SSSVPRN-KRVK 484

  Fly   529 NLNNS-----CSPKKSP-----------KNGGGEFQPFSTQKQSQTENEKTTQENGRGGSP---- 573
            .|:||     ...||:.           |....:.||: .|.||   :::|...|....:|    
 Frog   485 KLSNSKKAKILRAKKAEQMAAKRLLAKIKEANIKAQPY-MQAQS---SKRTAPRNKSNVAPVANA 545

  Fly   574 ------------------APAENNSNSNSSTLYNDNENPKTKKQRQALLQRNLTEQHRMQQDDEP 620
                              :|...|...::..|:|.:           :|..:|||....:..|..
 Frog   546 RPSRVIKAPRRFLDEAQLSPFTENQTKSNPMLHNAD-----------ILSSSLTEPEPEEISDPL 599

  Fly   621 PKNHTSPA--------------MPPPSPQSNSSSSSSSSSSANT-----HSSQSSHAVNNIPKPE 666
            |    ||.              :||.||::.|:.|..||:|:.|     .|...|...|.:..|.
 Frog   600 P----SPTDTFFNLFSEDHLCFLPPLSPEAESTPSCPSSASSPTLVSLPPSLSESKRKNILRAPT 660

  Fly   667 I--NNKATTDTPASPALVEQGDIDAKPAVSVHECDEEEEPAVNKVSPAHPDPP-----TTAAVAA 724
            .  |:..|.:..|...|                |  ...|.....|||.|..|     ..:|.::
 Frog   661 FCWNSVGTAEQEAPSTL----------------C--SSRPLFRLQSPASPLEPLQLNLPLSAPSS 707

  Fly   725 PPATESPK---KSSPAANS-------------ESCPFGEVEDKL--EQMFAGIEEE--------- 762
            ||....||   |.||...:             ||..|.:.:.|:  ..:.:..:..         
 Frog   708 PPPQPVPKLEPKRSPLLRAPQFTPSEAHLKIYESVSFEDRDGKVPFSPLLSNRQHHTDFTSSATA 772

  Fly   763 ----TERISSPEKPAEESAAMV----AHNLTA----------------------------QLALD 791
                ||.:|:|  .|::|...|    |::||.                            |:..|
 Frog   773 SVCTTETMSAP--AAKQSDLNVGGRRANHLTIPMFDSTLEKGDGLETNLLVTEPTLKPSDQILSD 835

  Fly   792 PSKTLDTPAENQTSVLAV----LAPNQTPTPEIRPVATKAAMKSTMPSPVHS--PIPQSRSTSTP 850
            |.:||:: ..|:...|.:    |.|..:|     .|..|.|:||...||..:  .|..|.:.:..
 Frog   836 PVETLNS-GYNRIGKLEMGAIKLGPVDSP-----GVVCKMAIKSPSLSPTDTLGEIGISSAVNDQ 894

  Fly   851 LVAGDDSKSNTPV-PAKAPAPRRPPPRRLSMGMDASLLRFMIDDPPAKKPGRKKKVTKEPDFE-- 912
            .::|.|.|..:.: .||....|....:...:|.|:          |.:.| |.|.|.:.|...  
 Frog   895 TLSGTDKKVISLLEKAKLQLIRIDKQKNSELGQDS----------PVQGP-RIKHVCRHPSVALG 948

  Fly   913 ------DDDKPSTSA--------AAAAALAARQLSEAASATKSKPAAGAKKKNAGVKGK------ 957
                  .:|.|..||        .|.:::|  |..|::||::.:.:...:|:.|.|:.|      
 Frog   949 QPRAMIPEDIPRLSALPLHEREPPAPSSIA--QPEESSSASEPESSTVKQKRAAPVRSKPKPPTK 1011

  Fly   958 ----KGSAG--KG-----------NAK--------NAKQN------------------GKKSARK 979
                .|..|  ||           |.|        |.|:.                  |||..:.
 Frog  1012 ARLRMGRCGTCKGCLVQDDCGKCINCKDKTKFGGPNTKKQCCVFRQCDAILARRLERAGKKGRKA 1076

  Fly   980 PA-----FTTDEDSTP-------APTNGGGSVPELRF------KSPFILIKPDGS---------V 1017
            ||     ....:|:.|       ...|...|:.:.:.      :.||..:.||..         |
 Frog  1077 PAPPRENLPDSDDNYPDTWRAEETEANDPDSLSQRKSSRRCVRQRPFYDLFPDSEDSDYDPGPRV 1141

  Fly  1018 SIKNTHSAEDV----NEKQTKVKKAPHERKNLR---GMHSSTLSN-------------------R 1056
            |.|.|....|:    :|:|:|.::.|.:...||   |....::.|                   :
 Frog  1142 SRKKTRRESDLLPQESEEQSKPRRTPQQPLILRARKGPEQESIMNGGSGKLKSADGTYRLRVDFK 1206

  Fly  1057 YDAD----------------TTDSTWICVFC-KRGPHKLGLGDLFGPYLVTSDCDE--YRAAVQ- 1101
            .|.|                ..:.|.:|:.| .||.|||         |....|.|  :|..:: 
 Frog  1207 EDCDLQNVWLMGGLSVLTSVPVNPTLMCLLCASRGRHKL---------LYCQVCCEPFHRFCLEE 1262

  Fly  1102 ----TPGAQDIDGMFVNKRRREDMVKGQ--ERNLPAVPATLANI------------MQAPK---- 1144
                .|..   :|.:..:|.:...|.||  :...|.:...|...            ::||:    
 Frog  1263 SERPLPNQ---EGTWCCRRCKFCNVCGQKGKAKKPLLECELCQTNYHVNCLGPNYPLKAPRSGKG 1324

  Fly  1145 --ISMHKRKRK----QTHDSSISYSDDPNESRSQCSSVDLLD----------CSTESKFVETFRG 1193
              .|...|.|.    ...|..:..::| ::..|:||:  |.|          |..||::......
 Frog  1325 WTCSACIRCRSCGIAPGKDGDLELTED-SKLCSECST--LYDKGNFCPICIRCYEESEYESKMIQ 1386

  Fly  1194 MGKTSENGFEVWLHEDCAVWSNDIHLIGAHVNGLDAAVWDSTRYQCVLC 1242
            ..|..:     |:|..|...|::.:.:.:::.       ||..|.|..|
 Frog  1387 CAKCDK-----WIHSKCEGLSDEGYELLSNLP-------DSVVYTCPPC 1423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 44/218 (20%)
kmt2bXP_002940678.2 zf-CXXC 1011..1058 CDD:251032 8/47 (17%)
PHD1_KMT2B 1233..1279 CDD:277064 14/58 (24%)
PHD2_KMT2A_like 1281..1330 CDD:276982 8/49 (16%)
PHD3_KMT2B 1367..1423 CDD:277068 12/68 (18%)
Bromodomain 1406..1548 CDD:295360 5/26 (19%)
ePHD_KMT2B 1617..1721 CDD:277164
FYRN 1769..1815 CDD:283589
FYRC 2515..2595 CDD:295414
SET <2673..2817 CDD:225491
SET 2679..2799 CDD:214614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.