DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and kmt2a

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_017951557.1 Gene:kmt2a XenbaseID:XB-GENE-922912 Length:3855 Species:Xenopus tropicalis

Alignment Length:1377 Identity:260/1378 (19%)
Similarity:430/1378 (31%) Gaps:451/1378 (33%)


  Fly   108 LQSARSAAQ-----PLAKQPPNQQPHQTQQQQQSLIHAPNYPSIQNLTTNATPTSTQLQQQQQQE 167
            ||.|:..||     ..||....:...|.:..:|.::     |.:..:::....|..:..:.:..|
 Frog   331 LQKAKKGAQKKMELEAAKLQGRKGGTQLKNIRQFIM-----PVVSTVSSRIIKTPRRFIEDEDYE 390

  Fly   168 HLAAMAAAHVSLLQSSRQNQGAPSGNLSNGGDCESLLPPPPPTSVSGNTNHTGSNSSSNSGSNNH 232
                 ....::.|:|      ||:|:..:...|.|          |..::.....||..:..::.
 Frog   391 -----PPIKIARLES------APNGSRFSTASCGS----------SEKSSAASQQSSQATSDDSR 434

  Fly   233 IASPHYMQSRDENFKLTQLKRSFEPDLSGKNPQKEKDFGYPSASSASKLPTHNVQQQ-------H 290
            .:||             .:..|.|...|.:.|...:..| ..|.:.:.:||   |||       .
 Frog   435 SSSP-------------SVDTSTESQASEETPVVSEPQG-RVAETITSVPT---QQQPLESNGVR 482

  Fly   291 ANKKPSPLRNYHQQQQPPYNLTPKYNGPQ---------TPPTPQSPLAANPHQ---------MLS 337
            ..:.|...:|:..:......|.|.:....         :||||..|.|:.|..         |.:
 Frog   483 TRRLPVCNKNFSSRPAKKIVLRPSFQQKSSVSPPPPLLSPPTPLQPSASLPDHTPWLMPAIPMAT 547

  Fly   338 PTMDYNQLHLHHQLNSSSGGSYQHMQQDQTQSQSHPQHLHYHNQHATS---------------QT 387
            |.:..:::|          ...:.:.::.|...:..:|....:|:.:|               ..
 Frog   548 PFISASRMH----------EKRRSILREPTFRWTSLKHSRLESQYFSSAKYAKEGLIRKPIFDNF 602

  Fly   388 APPPLLPP---LLTSGQFHAQ----PQDASQQQTASSSQHQTH----------------HSRTAQ 429
            .||||.|.   |.|:..|.:.    |........:|.::...|                |||   
 Frog   603 RPPPLTPEDVGLATASGFPSHTVVGPGRLFSHIHSSGARFDVHKRSPLLRAPRFTPSEAHSR--- 664

  Fly   430 LTNLDQAVKHKPESEEQPVITDLSYRNSETDKTAANPVPEA-PESPYLTTSNEESLESNSNSSNS 493
               :.::|...|.:......:.:...:..:.:...||:..: |:||             |:|..:
 Frog   665 ---IFESVTLPPSAGRASGTSSMMGISRRSKRRVFNPIRSSEPKSP-------------SHSMRT 713

  Fly   494 RKRRKRKASMVMRVTPNENAPEGENSKPQHPQQAANLNN-SCSP-KKSPKNGGGEFQPFSTQKQS 556
            |.||...:|:.:..:|                .:::|.: |.|| ..|..|....|...|....|
 Frog   714 RSRRVGNSSLSVLASP----------------PSSSLTDISVSPLATSALNPSFPFSSSSVTPAS 762

  Fly   557 QTENEKTTQENGRGGSPAPAENNSNSNSSTLYN------DNENPKTK--------KQRQALLQRN 607
            ....||..:......:||....:|.|:|..|:.      ..|..|:|        |:|:....|.
 Frog   763 VDIAEKIQKPRKPTSTPAEHFTSSPSSSPALFPWFPSSVQMEKGKSKNRGSVESSKEREVEKNRE 827

  Fly   608 LTEQHRMQQDDEPPKNHTSPAMPPPSPQSNSSSSSSSSSSANTHSSQSSHAVNNIPKPEINNKAT 672
            ...:....:|....|.             ..||.|....|...:..:.......| |..:..|  
 Frog   828 KDREKENSRDSRRDKR-------------KKSSDSGCKISRERNDEEGIVTATQI-KMSVRKK-- 876

  Fly   673 TDTPASPALVEQGDIDAKPAVSVHECDEEEEPAVNKVSPAHPDPPTTAAVAAPPATESPKKSSPA 737
                  |..|| .::|..|| |:|   .::.||.||:|                     ||..|.
 Frog   877 ------PVTVE-SNVDISPA-SIH---TDQIPAKNKIS---------------------KKGRPV 909

  Fly   738 ANS---ESC---PFGEVEDKL-EQMFAGIEEETERISSPEKPAEESAAMVAHNLT------AQLA 789
            :..   ::|   |..|.:.:| .|..:.::..:..|||....|::......|..|      |||.
 Frog   910 SEKTELDTCAKSPTAETQAQLPAQPVSALKHPSTSISSMLAQADKFPVSDKHVATLLRKAKAQLC 974

  Fly   790 -LDPSKTL---DTP----AENQTSVLAVLAPNQTPTPEIRPVATKAAM-----KSTMPS--PVHS 839
             ::.||.|   |.|    .|:.:|..:|..      |.|:.|..:||:     ::..|.  |..|
 Frog   975 KIEKSKFLKQTDQPKAQGQESDSSEASVRG------PRIKHVCRRAAVALGRKRAVFPDDMPTLS 1033

  Fly   840 PIPQSRSTSTPLVAGDDSKSNT--PVPAKAPAPRRPPPRRLSMGMDASLLRFMIDDPPAKKPGRK 902
            .:|...........|:|.||:.  ...|..|||...|.::::.....       .:||.||..|.
 Frog  1034 ALPWEEREKVLSSMGNDDKSSIAGSEDADQPAPPLKPIKQITRNKAQ-------QEPPVKKGRRS 1091

  Fly   903 KKVTKEPDFE--DDDKPSTSAAAAAALAARQLSEAASATKSKPAAGAKKKNAGVKGKKGSAGKGN 965
            ::..:.|..:  ||....|:.........|.:.:.....:       |.:|......|....| .
 Frog  1092 RRCGQCPGCQVPDDCGICTNCLDKPKFGGRNIKKQCCKMR-------KCQNLQWMPSKAYLQK-Q 1148

  Fly   966 AKNAKQNGKKSARKPAFTTDEDSTPAPTNGGGSVPELRFKSPF-ILIKPDGSVSIKNTHS----- 1024
            ||.|    ||..||...|..::..|.             |||. :::||   ||...|.|     
 Frog  1149 AKAA----KKKERKCKVTEKKELLPV-------------KSPSELIVKP---VSAPGTSSPPVQE 1193

  Fly  1025 ------------------AEDVNEKQ------TKVKKAPHERKNLRGMHS--STLSNRYDADTTD 1063
                              .|:.:|:|      ::.|::|:.||..:...|  ||.........|.
 Frog  1194 EPATPSLPQKKNEPPKKQTEEKSEEQIPAASTSETKQSPNSRKTTKQPPSQPSTTIAMTPLTATP 1258

  Fly  1064 STWICVFCKRGPHKLGLGDLFGPYLVTSDCDEYRAAVQTPGAQDIDGMFVNKRRREDM------- 1121
            ||     .|..|..:.              .|.|.. |.|...|......||:::..|       
 Frog  1259 ST-----KKEAPKPIP--------------PESRKK-QPPVLPDNTSTEQNKQKKLAMRLGALLK 1303

  Fly  1122 VKGQERNLPAVPA------TLANIMQAPKISMHKRKRKQTHDSSISYSDDPNESRSQCSSVDLLD 1180
            .||:|::.|..|:      .|.|.:....|:..|......|...:.:..               |
 Frog  1304 SKGKEKDKPQPPSKPEVSFNLLNTLCNGGITKQKPPSDGVHRIRVDFKH---------------D 1353

  Fly  1181 CSTESKFVETFRGMGKTSENGFEVWLHEDCAVWSNDIHLIGAHVNGLDAAVWD------------ 1233
            |..|:                                             |||            
 Frog  1354 CEVEN---------------------------------------------VWDMGGISLLTTAPV 1373

  Fly  1234 STRYQCVLCQQTG------ASICC--FQRCCKAAAHVPCGRSANWSLSEEDRKVYCHLH---RHE 1287
            :.|..|.||..:|      ..:||  |.|.|......|         ||:..:.:|..|   .|.
 Frog  1374 TPRVVCFLCASSGHVEFVYCQVCCEPFHRFCLEERERP---------SEDQIENWCCRHCKFCHV 1429

  Fly  1288 PGVVEPIKTESI 1299
            .|..:....|||
 Frog  1430 CGRQQQATKESI 1441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 40/249 (16%)
kmt2aXP_017951557.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.