DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and tcf20

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_002934760.1 Gene:tcf20 XenbaseID:XB-GENE-484162 Length:1849 Species:Xenopus tropicalis

Alignment Length:1695 Identity:325/1696 (19%)
Similarity:552/1696 (33%) Gaps:560/1696 (33%)


  Fly    11 HLSQAAQNASWNPLQ----------IPSYIPRQPQ--LAHMSNERP--GMVRSPLAWHVSGTVSA 61
            |:.|.: |:|..|||          :|...|.|.|  .:.:||..|  .:|:||       :.|:
 Frog   302 HVMQYS-NSSKLPLQSQTGQYSQSEVPVRSPMQFQQNFSPISNPSPAASVVQSP-------SCSS 358

  Fly    62 QPPPPPDAIYNF--------MSANHKNLDHHHQMNPLLAP-PYSGTL--------PFNSM-DLSL 108
            .|.|...:..|.        :|:.::.|    ||.|.|:| |:.|..        |...: |..|
 Frog   359 TPSPLMTSGENLTCGQGNVPLSSRNRIL----QMMPQLSPTPHGGGFKGFGVEGPPDKRLTDPGL 419

  Fly   109 QSARSAAQPLAKQP-------------PNQQP-------------HQTQQQQQSLIHAPNYPSIQ 147
            .|..:.:..:|..|             ||::.             .:|..|.:..:.:|...|:.
 Frog   420 SSLSALSSQVANLPNTVQHMLLSDALAPNKKSGKRTSRKADSCANSETSSQAEEQLKSPMAESLD 484

  Fly   148 NLTTN-------------------------------ATPT---STQLQQQQQQEHLAAMAAAHVS 178
            ...::                               |:||   ||:|.::.|.|.:..:..|..:
 Frog   485 GSCSSSSGDPGERVRQLSGQSTSSEAGYKGTSSEKPASPTQGWSTELSEKTQAEEVETVPEATET 549

  Fly   179 LLQSSRQNQGA-------------------PSGNLSNG--------------GDCESLLPPPP-- 208
            ..:.|:.::.:                   .|..|.|.              .|.:::...||  
 Frog   550 FQEVSKVSEKSVGVIVAMETVATRSEKVTEESSTLDNDEVETSSQPEVPETVKDDDNVKECPPDQ 614

  Fly   209 ----------PTSVSGNTNHTGSNSSSNSG---------SNNHIASPHYMQSRDENFKLTQLKRS 254
                      |..::.:|:.|.:.|...||         |.|....|.::::             
 Frog   615 NGEPSDADSQPVPITSSTSRTEAKSPVGSGFSFKEGATSSRNASNLPQHLKT------------- 666

  Fly   255 FEPDLSGKNPQKEKDFG------YPS----------------------------ASSASKLPTHN 285
              ||.:|...|.:|..|      |||                            :|.||..|  |
 Frog   667 --PDSAGCGGQGDKKSGTGRNDKYPSLLQEVLQGHHQQERRYARNTQDPPPVTGSSEASLRP--N 727

  Fly   286 VQQQHANKKPSPLRNYHQQQQPPYNLTPKYNGP-----------------------QTPPTPQSP 327
            :....|::.|:  ||...:...|:..||.: ||                       ..||.....
 Frog   728 ILMSQASELPN--RNILGKTLAPHLETPNW-GPWDRKSAPDVKPLNVTDYSARKFEVDPPASSQE 789

  Fly   328 LAANPHQMLSPTMDYNQLH--------LHH--QLNSSSGGSYQHM--------------QQDQTQ 368
            .:..|.:..|...|.:.|.        .||  |..|:.|.|.|.:              .|..|.
 Frog   790 SSGIPSERRSVICDISPLRQLVRDPTASHHVGQERSADGRSGQSVILPSGMISLDAKSSNQGGTP 854

  Fly   369 SQSHPQHLHYHNQHATSQTAPPPLLPPLLTSGQFHAQPQDASQQQTASSSQHQTH--HSR--TAQ 429
            .:...:....|.:..|....|    .....|.:.:..|:..:...|...|.|.:.  |.|  ||:
 Frog   855 KEQDTEATKMHRKRTTDHCIP----YSTKESARGNGSPRSMTFDPTQDYSPHNSRGPHPRRGTAR 915

  Fly   430 --------LTNLDQAVKHKPESEEQPVIT-------DLSYRNSETDKTAANPVPEAPESPYLTTS 479
                    :.:|...:|..|.....|..|       .||.|.|.          ||..|.:...:
 Frog   916 VGARGRSPVQDLGDKMKMSPGRSRGPAETHHMNPTMSLSERASR----------EAFYSAFFQNA 970

  Fly   480 NEESLESNSNSSNSRKRRKRKASMVMRVTPNENAPEGENSKPQHPQQAANLNNSCSPKKSPKNGG 544
            :..:|..:|||         :||......|...:|. ...:|.:.|:                  
 Frog   971 DNAALSYHSNS---------RASSYGEPHPTFTSPL-HYKRPVYQQE------------------ 1007

  Fly   545 GEFQPF-------STQKQSQTENEKTTQENGRGGSPAPAENN-SNSNSSTLYNDNENPKTKKQRQ 601
             ||:.:       ::|.:.:.:.:...||.....||...||. ...|....|:|:.:.:..:|.:
 Frog  1008 -EFKEWLGSSILSASQHRQEMQRKSPRQEQFHVRSPGRVENEVMVYNQPGAYHDSSSLEYGRQLR 1071

  Fly   602 ----------AL-LQRNLTEQHRMQQDDEPPKNHTSPAMPPPSPQSNSSSSSSSSSSANT--HSS 653
                      || |:||..:...:...:......|||.....||...:....||....:|  |.|
 Frog  1072 VGEGGPTNLTALELKRNAQKTPPVDSTNWNLGRQTSPVKKLGSPVGTNQKPFSSGRETDTLVHRS 1136

  Fly   654 QSSHAVN----NIPKPEINNKATTDTP------------ASPALVEQGDIDAK-PAVSVHECDEE 701
            .....::    |..:|:...:.:...|            ..|:..:.||...: |..:|.|  ..
 Frog  1137 GEGTEISKPGCNAHRPQGTEEQSHHNPLIMRRRVRSFISPIPSKRQPGDDKGRLPVSNVKE--TS 1199

  Fly   702 EEPAVNKVSPAHPDPPTTAAVAAPPATESPKKSSPAANSESCPFGEVEDKLEQMFAG----IEEE 762
            :..:|::|..:.......:.||..|....|:::||:|.|.|.|   .:.|:.....|    :|..
 Frog  1200 DRTSVSQVLTSRSKESGFSPVADEPHKGGPEQTSPSAVSLSSP---AKTKILPPRKGRGLKLEAI 1261

  Fly   763 TERISSP-----EKPAEESAAMVAHNLTAQLALD------------------------------- 791
            .::|:||     ..|:...:|..|..|...|:|.                               
 Frog  1262 VQKITSPNVRRISAPSSSESAAEAVTLDDILSLKIKGPESGKGSMQEAELPGVVGPDISCSEETT 1326

  Fly   792 ----PSKTLDTPAENQTSVLAVLAPNQTPTPEIRPVATKAAMKSTMPSPVHSPIPQSRSTSTPL- 851
                |.|:||..|.::..:...:        |.:.:.||....|.:|:...:.....:.|||.| 
 Frog  1327 AKSLPPKSLDVWAHDEKKIKTEM--------EEQSMETKDFSMSGLPAQASNHYMDGKGTSTALE 1383

  Fly   852 ----VAGDDSKSNTPVPAKAPAPRRPPPRRLSMGMDASLLRFMIDDPPAKKPGR-------KKKV 905
                :.......|......|..|....|::..:......       |..||.||       :||.
 Frog  1384 PKCVLPQVQQHENVEKEKLAGTPCNVTPKQEVIPQKGYF-------PSGKKKGRPVGSVNKQKKQ 1441

  Fly   906 TKEPDFED----DDKPSTSAAAAAALAARQLSEAASATKSKPAAGAKKKNAGVKGKKGSAGKGNA 966
            .::|..::    ...|..|.|:.:||..:.|.|....::::|    |.|....:.:|.:...   
 Frog  1442 QQQPLMQEQGHQQPPPPVSPASVSALPPQHLDEHLDISEAEP----KPKRRRTERRKPTGAP--- 1499

  Fly   967 KNAKQNGKKSARKPAFTTDEDSTPAP-TNGGGSVPELRFKS--PFILIKPDGSVSIK----NTHS 1024
              .::.||::|  |.....|...... .:.....||.:.||  |:|.::....:.:.    |...
 Frog  1500 --RRRRGKQAA--PIVAPIEPEIKLKYASQNLDKPETKTKSFIPYIHVENKEELGLSCVIINAEE 1560

  Fly  1025 AEDVNEKQTKVKK-----APHERKNLRGMHSSTLSNRYDADTTDSTW---ICVFCKRGPHKLGLG 1081
            .|...:|.|.|:|     :|....:.:.:.||:...:..|.|..:|.   :|..|.:..:...||
 Frog  1561 EEQHWKKLTSVRKGQRSASPQPSTDSKALPSSSFMVQGPAVTESATMGHLVCCLCGKWANYRNLG 1625

  Fly  1082 DLFGPYLVTSDCDEYRAAVQTPGAQDIDGMFVNKRRREDMVKGQERNLPAVPATLANIMQAPKIS 1146
            |||||:.    ..||.:.:                         .:|.|            ||.|
 Frog  1626 DLFGPFY----NQEYASTL-------------------------SKNPP------------PKKS 1649

  Fly  1147 MH-----KRKRKQTHDSSISYSD-----DPNESRSQCSSVDLL------------DCSTESKFVE 1189
            ..     |.:.|.|.|.|.|.||     :|.::|.|.|   |.            ||::....|.
 Frog  1650 SETPRKVKVRHKDTSDGSKSDSDEEEEEEPQQAREQRS---LTAHPRYKRRNRSGDCTSSRLTVP 1711

  Fly  1190 TFRGMGKTSE---------------------------NGFEVWLHEDCAVWSNDIHLIGAHVNGL 1227
            :.|.....||                           :..|.|:||.|.:|:|.::.:...:.||
 Frog  1712 SHRKTTDPSELTPMDSSGPSTAEAGPEQGVQIPQLPLDSNEFWMHEGCVLWANGVYFVCGRLYGL 1776

  Fly  1228 DAAVWDSTRYQCVLCQQTGASICCFQRCCKAAAHVPCGRSANWSLSEEDRKVYCHLHRHEPGVVE 1292
            ..||..:...:|..||:|||::.|:.:.|....|.||...:...|:||:..|.|  .:|:...|:
 Frog  1777 REAVDIAREMKCSHCQETGATLGCYNKGCACCYHFPCAMDSECLLNEENFSVRC--PKHKTKTVK 1839

  Fly  1293 PIKTE 1297
            .:.:|
 Frog  1840 GVSSE 1844

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 62/265 (23%)
tcf20XP_002934760.1 ePHD_TCF20 1612..1833 CDD:277169 62/267 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112723602
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003562
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.