DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5098 and tcf20

Sequence 1:NP_001261066.1 Gene:CG5098 FlyBaseID:FBgn0034300 Length:1339 Species:Drosophila melanogaster
Sequence 2:XP_005171593.1 Gene:tcf20 ZFINID:ZDB-GENE-110411-97 Length:2354 Species:Danio rerio

Alignment Length:1650 Identity:320/1650 (19%)
Similarity:512/1650 (31%) Gaps:578/1650 (35%)


  Fly    10 GHLSQAAQNASWNPLQIPSYIPRQPQLAHMSNERPGMVRSPLAWHVSGTVSAQPPPPPDAIYNFM 74
            |.:|::..|.|......||.:....|..|:...   .||:      ..|.||.            
Zfish   907 GMVSRSQDNNSQFQQVFPSLLQEVLQGHHLDRR---YVRA------EQTSSAH------------ 950

  Fly    75 SANHKNLDHHHQMNPLLAPPYSGTLPFNSMDLSLQSARSAAQ-PLAKQPPNQQPHQTQQQQQSLI 138
              .|......|:....|  |||.....:|..:..||...... ..::..|.:.|:.:|.....:.
Zfish   951 --QHSQDTSQHRFQTRL--PYSMIENLSSHSMGSQSVMGGLNVQFSQLAPGKSPNSSQGPDSEIG 1011

  Fly   139 HAPNYP------------SIQNLTTNATPTSTQLQQQQQQEHLAAMA-AAHVSLLQSSRQNQGAP 190
            ..|::|            ||:...|:.:|  :|....||...|:..| ..|::|...|.|::...
Zfish  1012 LGPSHPSWDSEAHKTHGISIEKSKTSLSP--SQSSHMQQSLDLSTGAPPKHINLADYSLQHRKPS 1074

  Fly   191 SGNLSNGGDCESLLPPPPPTSVS-GNTNHTGSNSSSNSGSNNHI-----------------ASPH 237
            ....|.....:.||....|.:.: |...|..|.:||:||..:.|                 :.|.
Zfish  1075 RYGTSPSAVEQLLLQEAEPLACNVGPVGHVQSQASSSSGRRSVICDVSPSRRTTPERERGSSGPS 1139

  Fly   238 YMQS------------RDE-NFKLTQLKRSFEP---DLSGKN--------PQKE--KDFGYP--- 273
            .:|.            ::| ..|..|:|.  :|   :.:|:|        |.||  |...:|   
Zfish  1140 VIQQPFSSGSNEQDCCKEEIKAKKAQIKE--DPSKVEAAGQNTDRYCSTPPSKESNKPLRHPVDS 1202

  Fly   274 -----SASSA-------SKLPTHNVQQQHANKKPSP------------LRNY------------- 301
                 ..|||       |.||  .:.|...|...||            ||.|             
Zfish  1203 DPDLEKTSSAKGNSDALSNLP--YLSQMPTNPLSSPQRLQSFSQAVDGLRAYGFGDAMDGQKMIP 1265

  Fly   302 ----HQ----------------------QQQPPY---NLTP--------KYNGPQTPP------T 323
                ||                      |..||.   :.||        ..:|||..|      .
Zfish  1266 HAGPHQPFHTLSAYTKTTASTNKLQVFPQSLPPQDRPDWTPDRQKLRGMDRHGPQRIPEQKCKSQ 1330

  Fly   324 PQSPLAANPHQMLSPTMDYNQLHLHHQLNSSSGGSYQHMQQDQTQSQSHPQH-------LHYHNQ 381
            |.|.:.::||::       :|.|           ||...|.|.....::|:.       .....:
Zfish  1331 PSSEILSSPHRI-------SQQH-----------SYPGAQFDLKMWDAYPEKEGAAQPLAAVPRE 1377

  Fly   382 HATSQTAPPPLLPPLLTSGQFHAQP--QDASQQQTASSSQHQTHHSRTAQLTNLDQAVKHKPESE 444
            |..||        |:..||...|:.  .|...:.|..|     .||.....||....||.....:
Zfish  1378 HVGSQ--------PITNSGPKIAKEDISDKGAEDTVKS-----FHSLAPASTNAGHTVKATQGIQ 1429

  Fly   445 EQPVITDLSYRNSETD--------KTAANPVP--------------EAPESPYLTTSNEESLESN 487
            :...:|... ..:||:        ::..:|:|              .|..||......|..:.:|
Zfish  1430 QGQRVTKTG-ALAETNPLIMRRRVRSFISPIPAKRQHQDVPGQRPGSAYHSPIAQAYPESRIATN 1493

  Fly   488 SNSSNSRKRRKRKASMVMRVTPNENAPEGENSKPQHPQQAANLNNSCSPKKSPKNGGGEFQPFST 552
            |.|.:|..:.|         .|:...|...:|....||..|..       ..|:.|.|.......
Zfish  1494 SCSGSSDSQAK---------LPSPKTPHSISSANSPPQSKAKF-------LPPRKGRGLKLEAIV 1542

  Fly   553 QKQSQTENEKTTQENGRGGSPAPAENNSN-----SNSSTLYNDNENPKTKKQRQALLQRNLTEQH 612
            ||.:.             |......||||     |.::...:|..:|::.....::.|...|...
Zfish  1543 QKITP-------------GVRKNDFNNSNLESDFSEAAHYTSDLPDPESGTSFTSVSQGEETCLS 1594

  Fly   613 RMQQDDEPPKNHTSPAMPPPSPQSNSSSSSSSSSSANTHSSQSSHAVNNIPKPEINNKATTDTPA 677
            .::.      :||...:.|.....::.|..|.|..|...:| ||.|:.::||.......|..:..
Zfish  1595 YLED------SHTLDELMPYRAVEDAFSCDSQSLKAGAAAS-SSGALRSLPKDFDFGLGTAGSSG 1652

  Fly   678 SPALVEQGDIDAKPAVSVHECDEEEEPAVNKVSPAHPDPPTTAAVAAPPATESPKKSSPAANSES 742
            |..               .|.|::|...:..:.||.|.|        .|...||..||.|.:.  
Zfish  1653 SLG---------------GENDKDEFTLLGPLPPAPPLP--------CPVQGSPPPSSSALSD-- 1692

  Fly   743 CPFGEVEDKLEQMFAGIEEETERISSPEKPAEESAAMVAHNLTAQLALDPSKTLD---------- 797
                      .|.|....::.|     .:.:|:|||    ||..|...:.....|          
Zfish  1693 ----------IQQFTNTYQQLE-----TRRSEQSAA----NLLRQKLQETGMGFDDYPGGDYYGT 1738

  Fly   798 ----TP--------AENQTSVLAVLAPNQTPTPEI-------------RPVAT-------KAAMK 830
                :|        ::||.:.|.:.:|:...:...             |||.:       :..|:
Zfish  1739 TAGHSPGHHLLSRGSQNQMTSLRLTSPDSKASESTVPKGYFPSGKKKGRPVGSVNKQKRAQGQMQ 1803

  Fly   831 ST--------MPSPVHSPIPQSRSTSTPLVAGDDSKSNTPVPAKAPAPRRPPPRRLS-MGMDASL 886
            :|        :|||  :..|||.|.|:.  |.:..:..|| |.:.|.|...||.... :.:||..
Zfish  1804 NTATNIPAAPLPSP--TAAPQSVSVSSN--ADEVPRVPTP-PDEKPCPSLVPPDETQVVKVDAES 1863

  Fly   887 LRFM--IDDPPAKKPGRKKKVTKEPDFEDDDK--------------PSTSAAAAAALAA------ 929
            ...:  :|..|.|:..:|.|...|......::              ..||:..:.:|:.      
Zfish  1864 EETLPELDVKPVKQKQKKGKECSETPASSGNQRRRRRGMASKEELDTQTSSRGSISLSGIFSDAR 1928

  Fly   930 -----------RQLSEAASATKSKPAAGAKKKNAGVKGKKGSAGKGN-------AKNAKQNGKKS 976
                       :::.|..:......|...|.|..|..|..|..|..|       .:..|:|.|. 
Zfish  1929 NSVFAPYVHVEKKMEEIGAVCTIINAEDEKSKGGGKPGHTGVDGPLNTLLPSQLVRKEKENEKS- 1992

  Fly   977 ARKPAFTTDE-DSTPAPTNGGGSVPELRFKSPFILIKPDGSVSIKNTHSAEDVNEKQTKVKKAPH 1040
              |..:.::: |||   ...|.::|...:..|..:|...|                         
Zfish  1993 --KENWVSEQVDST---LESGKALPTSEYVLPGPVISETG------------------------- 2027

  Fly  1041 ERKNLRGMHSSTLSNRYDADTTDSTWICVFCKRGPHKLGLGDLFGPYLVTSDCDEYRAAV----- 1100
                    ||..|             :|..|::..:...||||:||:...    ||.|.:     
Zfish  2028 --------HSGHL-------------LCCLCQKWANYKHLGDLYGPFYPA----EYAAKLPKNQP 2067

  Fly  1101 ---QT-----PGA------------QDI---DGMFVNKRRREDMVKGQERNLPAVPATLANIMQA 1142
               ||     |.|            ||.   :...|......|....|..|..: |||:...:..
Zfish  2068 QVRQTLSHFGPAATGMTSIPTEAIPQDTRLQEPQNVKSSAESDCTVSQATNTTS-PATIIGTVSP 2131

  Fly  1143 PKISM--------HKRKRKQTH--DSSISYSDDPNESRSQCSSVDLLDCSTESKFVET------- 1190
            ..:.|        ....|..||  |::...     ||....|::...|....||.::.       
Zfish  2132 MPLEMPFQNAIASSSTARVTTHAWDTAAEL-----ESGLGTSNLQETDAEIASKQLQVESSQQRP 2191

  Fly  1191 ----------FRGMGKTSE----------------------------------------NGFEVW 1205
                      |:...|:||                                        :..|:|
Zfish  2192 QHRKLTSHPRFKRRHKSSEDLPRTVPINSKASLPFQPPPPSLDALGPMAQLAQLPLVPLDPEELW 2256

  Fly  1206 LHEDCAVWSNDIHLIGAHVNGLDAAVWDSTRYQCVLCQQTGASICCFQRCCKAAAHVPCGRSANW 1270
            :||.|.||::.|:|:...:.||..|:..:....|..|:..|:::.|:.:.|....|..|...|:.
Zfish  2257 VHESCMVWTSGIYLVNGRLYGLQEALDGARDASCSHCEMAGSTLGCYSKGCTLRYHYICAIDADC 2321

  Fly  1271 SLSEEDRKVYCHLHR----HEPGVV 1291
            ||:|::..:.|..|:    .:||||
Zfish  2322 SLNEDNFSLRCPKHKGNRMAKPGVV 2346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5098NP_001261066.1 PHD_SF 1068..1284 CDD:304600 63/311 (20%)
tcf20XP_005171593.1 PHD_SF 2034..>2054 CDD:328929 8/20 (40%)
PHD_SF <2254..2335 CDD:328929 24/81 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112721330
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I4597
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T596716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14955
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9940
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.