DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5757 and yghR

DIOPT Version :9

Sequence 1:NP_001261065.1 Gene:CG5757 / 37062 FlyBaseID:FBgn0034299 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_417458.1 Gene:yghR / 947310 ECOCYCID:G7550 Length:252 Species:Escherichia coli


Alignment Length:218 Identity:48/218 - (22%)
Similarity:78/218 - (35%) Gaps:42/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIIFEGCDRSGKTTQSRLLVELL--------------------KSKGIPTLPMNFPERSSSIGQV 53
            ||...|||.:||:|.:..||:.|                    |.|.:|.:.:....|.::....
E. coli    23 LIAVVGCDGTGKSTLTTDLVKSLQQHWQTERRYLGLLSGEDGDKIKRLPLVGVWLERRLAAKSSK 87

  Fly    54 INSYLTNSKDLPDEVIHLMFSANRWEHINQVKEKLLEGTTLVVDR----------YSFSGVAYSA 108
            ..|..|.|..|...||...||..|..::.:|:.....|..:|.||          |...|:....
E. coli    88 TQSMKTKSPALWAAVIMYCFSLRRMANLRKVQRLAQSGVLVVSDRFPQAEISGFYYDGPGIGVER 152

  Fly   109 AKGLDFDWCYAPERGL------IKPDAVFYLRAPPNDLTHRGQYGKERYEKVEFQGRVAEVFNRI 167
            |.|....:....||.|      .:|:.:..|.........|    |..::..|.|.::. |.::|
E. coli   153 ATGKISMFLAQRERRLYQQMAQYRPELIIRLGIDIETAISR----KPDHDYAELQDKIG-VMSKI 212

  Fly   168 CSKEGSYFHQFDARQSVEDLHAQ 190
             ...|:...:.|:|....::..|
E. coli   213 -GYNGTKILEIDSRAPYSEVLEQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5757NP_001261065.1 PLN02924 1..197 CDD:178512 48/218 (22%)
Thymidylate_kin 12..191 CDD:280400 46/215 (21%)
yghRNP_417458.1 NK 23..239 CDD:418433 48/218 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0125
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.