DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5757 and tmk

DIOPT Version :9

Sequence 1:NP_001261065.1 Gene:CG5757 / 37062 FlyBaseID:FBgn0034299 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_415616.1 Gene:tmk / 945663 ECOCYCID:EG12302 Length:213 Species:Escherichia coli


Alignment Length:195 Identity:55/195 - (28%)
Similarity:86/195 - (44%) Gaps:17/195 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RGALIIFEGCDRSGKTTQSRLLVELLKSKGIPTLPMNFPERSSSIGQVINSYLTNSKDLPDEVIH 70
            |...|:.||.:.:||||...::||.|:..||..:........:.:.:.:.|.:.:.|.:.||||.
E. coli     2 RSKYIVIEGLEGAGKTTARNVVVETLEQLGIRDMVFTREPGGTQLAEKLRSLVLDIKSVGDEVIT 66

  Fly    71 -----LMFSANRWEHINQV-KEKLLEGTTLVVDRYSFSGVAY-SAAKGLDFDWCYAPER----GL 124
                 |||.|.|.:.:..| |..|..||.::.||:..|..|| ...:|:| ....|..|    |.
E. coli    67 DKAEVLMFYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGID-QHMLATLRDAVLGD 130

  Fly   125 IKPDAVFYLRAPP----NDLTHRGQYGKERYEKVEFQGRVAEVFNRICSKEGSYFHQFDARQSVE 185
            .:||...||...|    .....||:..:...|..:|..|....:..:.:::.| .|..||.|.:|
E. coli   131 FRPDLTLYLDVTPEVGLKRARARGELDRIEQESFDFFNRTRARYLELAAQDKS-IHTIDATQPLE 194

  Fly   186  185
            E. coli   195  194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5757NP_001261065.1 PLN02924 1..197 CDD:178512 55/195 (28%)
Thymidylate_kin 12..191 CDD:280400 53/189 (28%)
tmkNP_415616.1 tmk 1..209 CDD:234814 55/195 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I633
eggNOG 1 0.900 - - E1_COG0125
Hieranoid 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I431
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003433
OrthoInspector 1 1.000 - - oto111975
orthoMCL 1 0.900 - - OOG6_100714
Panther 1 1.100 - - O PTHR10344
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
98.860

Return to query results.
Submit another query.