DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5757 and Cmpk2

DIOPT Version :9

Sequence 1:NP_001261065.1 Gene:CG5757 / 37062 FlyBaseID:FBgn0034299 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001101487.1 Gene:Cmpk2 / 314004 RGDID:1305881 Length:417 Species:Rattus norvegicus


Alignment Length:175 Identity:40/175 - (22%)
Similarity:70/175 - (40%) Gaps:23/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIIFEGCDRSGKTTQSRLLVELLKSKGIPTLPMNFPERSSSIGQVINSYLTNSKDLPDEVIHLMF 73
            :|..||.|.:||||.::.:.|.|::..:.:.|           ..|:.:.....|.|..:....:
  Rat   224 VIAIEGLDATGKTTLTQSVSESLQAVLLQSPP-----------PCISQWRKLFDDEPTIIRRAFY 277

  Fly    74 SANRWEHINQVKEKLLEGTTLVVDRYSFSGVAYSAAKGLDFDWCYAP---------ERGLIKPDA 129
            |...:...:::.::..: ..::||||..|...|:.|..:.....|.|         .|.|:|||.
  Rat   278 SLGNYLVASEIAKQSAK-FPVIVDRYWHSTATYAIATEVSGGLQYLPPAHHPVYQWPRDLLKPDL 341

  Fly   130 VFYLRAPPNDLTHRGQYGKERYEKVEFQGRVAEVFNRICSKEGSY 174
            |..|.....:...|.|...:...|.|.:..|..||.:  ..|.:|
  Rat   342 VLLLTVNSEERVRRLQGRGQEKTKEEAELEVNSVFRQ--KVEATY 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5757NP_001261065.1 PLN02924 1..197 CDD:178512 40/175 (23%)
Thymidylate_kin 12..191 CDD:280400 39/172 (23%)
Cmpk2NP_001101487.1 NK 225..413 CDD:418433 40/174 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0125
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.