| Sequence 1: | NP_001261065.1 | Gene: | CG5757 / 37062 | FlyBaseID: | FBgn0034299 | Length: | 211 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_065582.3 | Gene: | Cmpk2 / 22169 | MGIID: | 99830 | Length: | 447 | Species: | Mus musculus |
| Alignment Length: | 207 | Identity: | 47/207 - (22%) |
|---|---|---|---|
| Similarity: | 82/207 - (39%) | Gaps: | 36/207 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 LIIFEGCDRSGKTTQSRLLVELLKSKGIPTLPMNFPERSSSIGQVINSYLTNSKDLPDEVIHLMF 73
Fly 74 SANRWEHINQVKEKLLEGTT--LVVDRYSFSGVAYSAAKGLDFDWCYAPER---------GLIKP 127
Fly 128 DAVFYLRAPPND----LTHRGQYGKERYEKVE----FQGRVAEVFNRICSKEGSYFHQFDARQSV 184
Fly 185 EDLHAQIASITE 196 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5757 | NP_001261065.1 | PLN02924 | 1..197 | CDD:178512 | 47/207 (23%) |
| Thymidylate_kin | 12..191 | CDD:280400 | 46/197 (23%) | ||
| Cmpk2 | NP_065582.3 | Tmk | 248..443 | CDD:223203 | 47/205 (23%) |
| NK | 255..444 | CDD:302627 | 47/206 (23%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0125 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||