powered by:
Protein Alignment CG10911 and NPIPA1
DIOPT Version :9
Sequence 1: | NP_611286.1 |
Gene: | CG10911 / 37058 |
FlyBaseID: | FBgn0034295 |
Length: | 359 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_008916.2 |
Gene: | NPIPA1 / 9284 |
HGNCID: | 7909 |
Length: | 350 |
Species: | Homo sapiens |
Alignment Length: | 66 |
Identity: | 12/66 - (18%) |
Similarity: | 28/66 - (42%) |
Gaps: | 14/66 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 LNACLETASQEVSQIN----DNTKEERDAIDASAKSSCDA----------LTACSTKEAAIDYFQ 121
:|...:||.:.:.::: ::.::||...:|......|. ..|.:.:..|.||::
Human 136 INGKRKTAKEHLRKLSMKEREHGEKERQVSEAEENGKLDMKEIHTYMEMFQRAQALRRRAEDYYR 200
Fly 122 C 122
|
Human 201 C 201
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_28UXN |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.