DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10911 and H03A11.2

DIOPT Version :8

Sequence 1:NP_611286.1 Gene:CG10911 / 37058 FlyBaseID:FBgn0034295 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_510528.3 Gene:H03A11.2 / 181617 WormBaseID:WBGene00010357 Length:1218 Species:Caenorhabditis elegans

Alignment Length:157 Identity:38/158 (24%)
Similarity:64/158 (41%) Gaps:19/158 (12%)


  Fly   181 LGDCIAGAPIPSESTSTQASSTDSSTDSTSASTESSTDSSSVSTESS--TDSSSVSTESSTDSST 243
            |||...|  :..|.:.||.|...||....|..|   |.:...||.||  |:.::..|..:...:.
 Worm    30 LGDGKTG--LSQEKSITQTSFESSSYHQKSQRT---TPTRHYSTISSLFTEENNTGTGGTQTRNI 89

  Fly   244 DSSSASTESSTDSSSVSTESSTDSST---------DSSSVSTESSTDSSTDSSSASTESSTESSS 299
            .||....::.....||:...||...|         |:...:::|..:.   :|.:|.:.:....|
 Worm    90 KSSEYRAKTQNGEQSVAETRSTQRETVQLPPILKADNGRATSQSGRER---NSRSSIQQALRQHS 151

  Fly   300 DSPSDSTESSTDSSSVSTESTTSSGEK 326
            :..::|.||...|:....:.|.|..|:
 Worm   152 EERANSAESKRQSTLTGAKKTVSINEQ 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10911NP_611286.1 DUF725 48..168 CDD:283039
H03A11.2NP_510528.3 STOP 6..>31 CDD:310081 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28UXN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.