DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10911 and NPIPA5

DIOPT Version :8

Sequence 1:NP_611286.1 Gene:CG10911 / 37058 FlyBaseID:FBgn0034295 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_024305900.1 Gene:NPIPA5 / 100288332 HGNCID:41980 Length:369 Species:Homo sapiens

Alignment Length:66 Identity:12/67 (18%)
Similarity:28/67 (42%) Gaps:14/67 (21%)


  Fly    71 LNACLETASQEVSQIN----DNTKEERDAIDASAKSSCDA----------LTACSTKEAAIDYFQ 121
            :|...:||.:.:.:::    ::.::||...:|......|.          ..|.:.:..|.||::
Human   155 INGKRKTAKEHLRKLSMKEREHGEKERQVSEAEENGKLDMKEIHTYMEMFQRAQALRRRAEDYYR 219

  Fly   122 C 122
            |
Human   220 C 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10911NP_611286.1 DUF725 48..168 CDD:283039 12/67 (18%)
NPIPA5XP_024305900.1 AFD_class_I <1..41 CDD:327384
NPIP 41..240 CDD:310774 12/67 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28UXN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.