DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-A and ALG2

Sequence 1:NP_001286547.1 Gene:PIG-A FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_011450.1 Gene:ALG2 SGDID:S000003033 Length:503 Species:Saccharomyces cerevisiae

Alignment Length:546 Identity:104/547 (19%)
Similarity:184/547 (34%) Gaps:175/547 (32%)


  Fly     9 FFYP--SIGGVEEHVYNLSQMLLSLGHKIVVLT------HAYGDCSGIRYVTGYLKVY----YLP 61
            |.:|  .|||.|..|.:.:..|...||.:::.|      |.:.:..     .|.|||.    :||
Yeast    11 FIHPDLGIGGAERLVVDAALGLQQQGHSVIIYTSHCDKSHCFEEVK-----NGQLKVEVYGDFLP 70

  Fly    62 IKVCYNQCILPTAVCNVPMLRAVLLRERVEVVHGHSAFSALAHEALMVGSL---LGLKTVFTDHS 123
            ........|:...:..:.::..::|:::|.           |::.:::..|   :.|..:|:..:
Yeast    71 TNFLGRFFIVFATIRQLYLVIQLILQKKVN-----------AYQLIIIDQLSTCIPLLHIFSSAT 124

  Fly   124 LFGFADLSAALTNNLLEVNLGMVNHAICVSHIGKENTVLRA---RVAKHRVSVIPNAVDTALFTP 185
            |..:..    ..:.||....|::            ..:.|.   .:.:..||.....|..:.||.
Yeast   125 LMFYCH----FPDQLLAQRAGLL------------KKIYRLPFDLIEQFSVSAADTVVVNSNFTK 173

  Fly   186 ------------DPQQ-RPSNDIINIVVAS------RLVYRKGIDLLAGIIPRFKN--------- 222
                        ||.. .|..|:..|.:..      :.|:.:| |.....|.||:.         
Yeast   174 NTFHQTFKYLSNDPDVIYPCVDLSTIEIEDIDKKFFKTVFNEG-DRFYLSINRFEKKKDVALAIK 237

  Fly   223 ---------TPNINFIIVGDGPKR--DLLEEIREKTNMQERVQM----VGAVEHNRVRD------ 266
                     ..|:..:|.|...:|  :.:|.::|..::.:..::    :...|..||.|      
Yeast   238 AFALSEDQINDNVKLVICGGYDERVAENVEYLKELQSLADEYELSHTTIYYQEIKRVSDLESFKT 302

  Fly   267 ------------------FLVRGHIFLNTSLTEAYCMAIVEAASCGLQVVSTSVGGIPEVLPKSL 313
                              .|.|..:.|.|...|.:.:..:||...|..|::.:.||..|.: ||.
Yeast   303 NNSKIIFLTSISSSLKELLLERTEMLLYTPAYEHFGIVPLEAMKLGKPVLAVNNGGPLETI-KSY 366

  Fly   314 ILLAEPEIDA---IYAAILI----AIDRHRKSSFKVSPSVGNGHLASDANG--KVKRRRRRKVDT 369
            : ..|.|..|   :..|:.|    |||..||       .:.||.:..:.||  :||:...|:..|
Yeast   367 V-AGENESSATGWLKPAVPIQWATAIDESRK-------ILQNGSVNFERNGPLRVKKYFSREAMT 423

  Fly   370 PISPTQLPAVSAPPADQNSSTEPVMCPYRCNELVETLYNWEDVALRTVKVYDRVLNERSFTTSEL 434
                              .|.|.               |.|.|..:..|.|...:...||:...|
Yeast   424 ------------------QSFEE---------------NVEKVIWKEKKYYPWEIFGISFSNFIL 455

  Fly   435 VFA---VWQHGSW---FLVFFVVAHF 454
            ..|   :..:..|   |:..|:|.:|
Yeast   456 HMAFIKILPNNPWPFLFMATFMVLYF 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 68/385 (18%)
GT1_PIG-A_like 2..451 CDD:99970 102/542 (19%)
ALG2NP_011450.1 RfaB 6..437 CDD:223515 93/501 (19%)
GT1_ALG2_like 7..426 CDD:99977 89/475 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.