DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-A and ALG1

Sequence 1:NP_001286547.1 Gene:PIG-A FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_009668.3 Gene:ALG1 SGDID:S000000314 Length:449 Species:Saccharomyces cerevisiae

Alignment Length:319 Identity:60/320 (19%)
Similarity:122/320 (38%) Gaps:69/320 (22%)


  Fly    70 ILPTAV------CNVPMLRAVLLRERVEVVHGHS-AFSALA--------HEALMVGSLLGLKTVF 119
            |||.||      |.:             ::..|: |:|.|.        |..:::..:  ::.:|
Yeast   143 ILPIAVLYKLTGCKL-------------IIDWHNLAYSILQLKFKGNFYHPLVLISYM--VEMIF 192

  Fly   120 TDHSLFGFADLSAALTNNLLEVNLGMVNHAICVSHIG-KENTVLRARVAKH---------RVSVI 174
            :.     |||.:..:|.       .|..:.|...|:. |...||..|.|..         |...:
Yeast   193 SK-----FADYNLTVTE-------AMRKYLIQSFHLNPKRCAVLYDRPASQFQPLAGDISRQKAL 245

  Fly   175 PNAVDTALFTPDPQQRPSNDIINIVVASRLVYRKGIDLLAGIIPRFKNT--------PNINFIIV 231
            ........:..|.......|.| ||.::.....:.|.:|.|.:..::|:        |.|...|.
Yeast   246 TTKAFIKNYIRDDFDTEKGDKI-IVTSTSFTPDEDIGILLGALKIYENSYVKFDSSLPKILCFIT 309

  Fly   232 GDGP-KRDLLEEIREKTNMQERVQMV--GAVEHNRVRDFLVRGHIFLNTSLTEA-YCMAIVEAAS 292
            |.|| |...::::.|....:.:::.|  .|.::.::......| :.|:||.:.. ..|.|::...
Yeast   310 GKGPLKEKYMKQVEEYDWKRCQIEFVWLSAEDYPKLLQLCDYG-VSLHTSSSGLDLPMKILDMFG 373

  Fly   293 CGLQVVSTSVGGIPEVLPKSLILLAEPEIDAIYAAILIAI---DRHRKSSFKVSPSVGN 348
            .||.|::.:...:.|::..::..|...:...::.:::.|:   |.::|....|:....|
Yeast   374 SGLPVIAMNYPVLDELVQHNVNGLKFVDRRELHESLIFAMKDADLYQKLKKNVTQEAEN 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 54/276 (20%)
GT1_PIG-A_like 2..451 CDD:99970 60/320 (19%)
ALG1NP_009668.3 GT1_ALG1_like 36..445 CDD:99986 60/320 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.