Sequence 1: | NP_001286547.1 | Gene: | PIG-A / 37020 | FlyBaseID: | FBgn0034270 | Length: | 479 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061982.3 | Gene: | ALG1 / 56052 | HGNCID: | 18294 | Length: | 464 | Species: | Homo sapiens |
Alignment Length: | 267 | Identity: | 50/267 - (18%) |
---|---|---|---|
Similarity: | 96/267 - (35%) | Gaps: | 91/267 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 VGSLLGLKTVFTDHSLFGFADLS--------AALTNNLLEVNLGMVNHA-ICVSHIGKE----NT 160
Fly 161 VLRARVA---------------KHRVSVIPNAVDT---ALFTP-DP------------------- 187
Fly 188 -QQRPSNDIINIVVASRLVYRKGIDLLAGIIPRFK-------NTPNINFIIVGDGPKRDLLEEIR 244
Fly 245 EKTNMQERVQMVGAVEHNRVRDFLVRGHIFLNTSLTEA--YCMAIVEAASCGLQVVSTSVGGIPE 307
Fly 308 VLPKSLI 314 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PIG-A | NP_001286547.1 | RfaB | 1..309 | CDD:223515 | 48/260 (18%) |
GT1_PIG-A_like | 2..451 | CDD:99970 | 50/267 (19%) | ||
ALG1 | NP_061982.3 | PLN02275 | 27..424 | CDD:215155 | 50/267 (19%) |
GT1_ALG1_like | 30..461 | CDD:99986 | 50/267 (19%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 243..262 | 4/18 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0438 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |