DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-A and ALG1

DIOPT Version :9

Sequence 1:NP_001286547.1 Gene:PIG-A / 37020 FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_061982.3 Gene:ALG1 / 56052 HGNCID:18294 Length:464 Species:Homo sapiens


Alignment Length:267 Identity:50/267 - (18%)
Similarity:96/267 - (35%) Gaps:91/267 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 VGSLLGLKTVFTDHSLFGFADLS--------AALTNNLLEVNLGMVNHA-ICVSHIGKE----NT 160
            ||.|.|.|.|...|: :|::.:.        ..|.....|...|.::|. :||::..:|    |.
Human   144 VGCLCGSKLVIDWHN-YGYSIMGLVHGPNHPLVLLAKWYEKFFGRLSHLNLCVTNAMREDLADNW 207

  Fly   161 VLRARVA---------------KHRVSVIPNAVDT---ALFTP-DP------------------- 187
            .:||...               :||:.:...::.:   |...| ||                   
Human   208 HIRAVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDPVTERSAFTERDAGSGLVTR 272

  Fly   188 -QQRPSNDIINIVVASRLVYRKGIDLLAGIIPRFK-------NTPNINFIIVGDGPKRDLLEEIR 244
             ::||:    .:|.::.....:...:|...:.:|:       |.|::..:|.|.||.|:....:.
Human   273 LRERPA----LLVSSTSWTEDEDFSILLAALEKFEQLTLDGHNLPSLVCVITGKGPLREYYSRLI 333

  Fly   245 EKTNMQERVQMVGAVEHNRVRDFLVRGHIFLNTSLTEA--YCMAIVEAASCGLQVVSTSVGGIPE 307
            .:.:.|                     ||.:.|...||  |.: ::.:|..|: .:.||..|:. 
Human   334 HQKHFQ---------------------HIQVCTPWLEAEDYPL-LLGSADLGV-CLHTSSSGLD- 374

  Fly   308 VLPKSLI 314
             ||..::
Human   375 -LPMKVV 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 48/260 (18%)
GT1_PIG-A_like 2..451 CDD:99970 50/267 (19%)
ALG1NP_061982.3 PLN02275 27..424 CDD:215155 50/267 (19%)
GT1_ALG1_like 30..461 CDD:99986 50/267 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..262 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.