DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-A and PIGA

Sequence 1:NP_001286547.1 Gene:PIG-A FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_002632.1 Gene:PIGA HGNCID:8957 Length:484 Species:Homo sapiens

Alignment Length:477 Identity:233/478 (49%)
Similarity:303/478 (63%) Gaps:61/478 (13%)


  Fly     3 ICMVSDFFYPSIGGVEEHVYNLSQMLLSLGHKIVVLTHAYGDCSGIRYVTGYLKVYYLPIKVCYN 67
            ||||||||||::||||.|:|.|||.|:..|||::::|||||:..||||:|..|||||||:||.||
Human    35 ICMVSDFFYPNMGGVESHIYQLSQCLIERGHKVIIVTHAYGNRKGIRYLTSGLKVYYLPLKVMYN 99

  Fly    68 QCILPTAVCNVPMLRAVLLRERVEVVHGHSAFSALAHEALMVGSLLGLKTVFTDHSLFGFADLSA 132
            |....|...::|:||.:.:||||.::|.||:|||:||:||.....:||:|||||||||||||:|:
Human   100 QSTATTLFHSLPLLRYIFVRERVTIIHSHSSFSAMAHDALFHAKTMGLQTVFTDHSLFGFADVSS 164

  Fly   133 ALTNNLLEVNLGMVNHAICVSHIGKENTVLRARVAKHRVSVIPNAVDTALFTPDPQQRPSNDIIN 197
            .|||.||.|:|...||.||||:..||||||||.:....|||||||||...|||||.:|  :|.|.
Human   165 VLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRR--HDSIT 227

  Fly   198 IVVASRLVYRKGIDLLAGIIPRF-KNTPNINFIIVGDGPKRDLLEEIREKTNMQERVQMVGAVEH 261
            |||.||||||||||||:||||.. :..|::||||.|:||||.:|||:||:..:.:||:::||:||
Human   228 IVVVSRLVYRKGIDLLSGIIPELCQKYPDLNFIIGGEGPKRIILEEVRERYQLHDRVRLLGALEH 292

  Fly   262 NRVRDFLVRGHIFLNTSLTEAYCMAIVEAASCGLQVVSTSVGGIPEVLPKSLILLAEPEIDAIYA 326
            ..||:.||:||||||||||||:|||||||||||||||||.|||||||||::||:|.||.:.::..
Human   293 KDVRNVLVQGHIFLNTSLTEAFCMAIVEAASCGLQVVSTRVGGIPEVLPENLIILCEPSVKSLCE 357

  Fly   327 AILIAIDRHRKSSFKVSPSVGNGHLASDANGKVKRRRRRKVDTPISPTQLPAVSAPPADQNSSTE 391
            .:       .|:.|::....                             |||             
Human   358 GL-------EKAIFQLKSGT-----------------------------LPA------------- 373

  Fly   392 PVMCPYRCNELVETLYNWEDVALRTVKVYDRVLNERSFTTSELVFAVWQH----GSWFLVFFVVA 452
                |...:.:|:|.|.|.:||.||.||||||..|......:.:..:..|    ..:......|.
Human   374 ----PENIHNIVKTFYTWRNVAERTEKVYDRVSVEAVLPMDKRLDRLISHCGPVTGYIFALLAVF 434

  Fly   453 HFLMRLLELW-RPRKHVEIAQD 473
            :||..:...| .|...:::|.|
Human   435 NFLFLIFLRWMTPDSIIDVAID 456

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 197/307 (64%)
GT1_PIG-A_like 2..451 CDD:99970 226/453 (50%)
PIGANP_002632.1 GT1_PIG-A_like 34..432 CDD:99970 226/452 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150835363
eggNOG 1 0.900 E1_COG0438
Hieranoid 1 1.000
Homologene 1 1.000 H1982
Inparanoid 1 1.050 420 1.000 Inparanoid score I1775
Isobase 1 0.950 0 Normalized mean entropy S691
OMA 1 1.010
OrthoDB 1 1.010 D305260at33208
OrthoFinder 1 1.000 FOG0004176
OrthoInspector 1 1.000 T1072934
orthoMCL 1 0.900 OOG5_127105
Panther 1 1.100 LDO PTHR45871
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R517
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.