DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-A and alg11

Sequence 1:NP_001286547.1 Gene:PIG-A FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_989283.1 Gene:alg11 XenbaseID:XB-GENE-5934131 Length:487 Species:Xenopus tropicalis

Alignment Length:315 Identity:54/316 (17%)
Similarity:97/316 (31%) Gaps:116/316 (37%)


  Fly    24 LSQMLLSLGHKIVVLTHAYGDCSGIRYVTG-YLKVYYLPIKVCYNQCILPTAVCNVPMLRAVLLR 87
            ||::.|...:...|:....|.||.:..|.. :...:.|.:..|..:..:....|:|.....:.|.
 Frog   227 LSRLKLIYYYLFAVIYGWVGSCSDVIMVNSTWTFAHILDLWKCSERTSIVYPPCDVQTFLDINLN 291

  Fly    88 ERVEVVHGHSAFSALAHEALMVGSLLGLKTVFTDHSL--FGFADLSAALTNNLLEVNLGMVNHAI 150
            :..::..         |..:.:|.....|    ||.|  ..||.|....|...|::.|.::.   
 Frog   292 QHKDIEE---------HSIVSIGQFRPEK----DHPLQICAFAALLKKKTTEKLKLKLILIG--- 340

  Fly   151 CVSHIGKENTVLRARVAKHRVSVIPNAVDTALFTPDPQQRPSNDIINIVVASRLVYRKGIDLLAG 215
                 |..|.....||::.:                            .::|.|          |
 Frog   341 -----GCRNNEDELRVSELK----------------------------KLSSEL----------G 362

  Fly   216 IIPRFKNTPNINFIIVGDGPKRDLLEEIREKTNMQERVQMVGAVEHNRVRDFLVRGHIFLNTSLT 280
            |...||    :|.      |..:|.:.:.|.|                         |.|:|...
 Frog   363 IPVEFK----VNI------PFAELKKHLSEAT-------------------------IGLHTMWN 392

  Fly   281 EAYCMAIVEAASCGLQVVSTSVGGIPEVLPKSLILLAEPEIDAIYAAILIAIDRH 335
            |.:.:.|||..:.|..:::.:.||              |::|     |::..:.|
 Frog   393 EHFGIGIVECMAAGTIILAHNSGG--------------PKLD-----IVVPYEEH 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 50/288 (17%)
GT1_PIG-A_like 2..451 CDD:99970 54/316 (17%)
alg11NP_989283.1 GT1_ALG11_like 61..477 CDD:99978 54/316 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.