DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-A and Alg1

Sequence 1:NP_001286547.1 Gene:PIG-A FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_663337.2 Gene:Alg1 MGIID:2384774 Length:482 Species:Mus musculus

Alignment Length:354 Identity:61/355 (17%)
Similarity:118/355 (33%) Gaps:114/355 (32%)


  Fly    34 KIVVLTHAYGDCSGIRYVTGYLKVYYLPIKVCYNQCILPTA----VCNVPMLRAVLLRERVEVVH 94
            :||.||...|..:|.|.:...:||.:..:.:.:....:..|    :.|.|.|.|:.:        
Mouse    84 RIVKLTDLRGLGAGPRILQYGVKVVFQAVYLLWKMMRMDPAAYIFLQNPPGLPAIAV-------- 140

  Fly    95 GHSAFSALAHEALMVGSLLGLKTVFTDHSLFGFADLS--------AALTNNLLEVNLGMVNHA-I 150
                       ...||.:.|.|.|...|: :|::.:.        ..|.....|...|.::|. :
Mouse   141 -----------CWFVGCICGSKLVIDWHN-YGYSIMGLVHGPRHPIVLLAKWYEKFFGRLSHLNL 193

  Fly   151 CVSHIGK----ENTVLRA-----------------------RVAKHRVSVIPNAVDTALFTPDPQ 188
            ||::..:    ||..:||                       ....|..|...:..|.:  .||.:
Mouse   194 CVTNAMREDLAENWCVRAVTLYDKPASFFKETPLDLQHELFMKLSHTYSPFQSCSDPS--HPDTE 256

  Fly   189 Q------------------RPSNDIINIVVASRLVYRKGIDLLAGIIPRFK-------NTPNINF 228
            :                  ||:    .:|.::.....:...:|...:.:|:       :.|::..
Mouse   257 RSAFTERDCQSGVVRRLHGRPA----LLVSSTSWTEDEDFSILLRALEKFEQQALTGDSLPSLVC 317

  Fly   229 IIVGDGPKRDLLEEIREKTNMQERVQMVGAVEHNR-------VRDF-LVRGHIFLNTSLTEAYC- 284
            :|.|.||.|:....:..:.::|          |.|       ..|: |:.|...|...|..:.. 
Mouse   318 VITGKGPLREHYRHLISQKHLQ----------HVRFCTPWLEAEDYPLLLGSADLGVCLHMSSSG 372

  Fly   285 ----MAIVEAASCGLQVVSTSVGGIPEVL 309
                |.:|:...|.|.|.:.:...:.|::
Mouse   373 LDLPMKVVDMFGCHLPVCAVNFKCLHELV 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 61/353 (17%)
GT1_PIG-A_like 2..451 CDD:99970 61/355 (17%)
Alg1NP_663337.2 PLN02275 29..424 CDD:215155 61/355 (17%)
GT1_ALG1_like 33..461 CDD:99986 61/355 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.