DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-A and Piga

Sequence 1:NP_001286547.1 Gene:PIG-A FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_035211.2 Gene:Piga MGIID:99461 Length:485 Species:Mus musculus

Alignment Length:484 Identity:230/485 (47%)
Similarity:305/485 (63%) Gaps:62/485 (13%)


  Fly     3 ICMVSDFFYPSIGGVEEHVYNLSQMLLSLGHKIVVLTHAYGDCSGIRYVTGYLKVYYLPIKVCYN 67
            ||||||||||::||||.|:|.|||.|:..|||::.:|||||:..|:||:|..|||||||::|.||
Mouse    35 ICMVSDFFYPNMGGVESHIYQLSQCLIERGHKVITVTHAYGNRKGVRYLTNGLKVYYLPLRVMYN 99

  Fly    68 QCILPTAVCNVPMLRAVLLRERVEVVHGHSAFSALAHEALMVGSLLGLKTVFTDHSLFGFADLSA 132
            |....|...::|:||.:.:|||:.::|.||:|||:||:||.....:||:|||||||||||||:|:
Mouse   100 QSTATTLFHSLPLLRYIFVRERITIIHSHSSFSAMAHDALFHAKTMGLQTVFTDHSLFGFADVSS 164

  Fly   133 ALTNNLLEVNLGMVNHAICVSHIGKENTVLRARVAKHRVSVIPNAVDTALFTPDPQQRPSNDIIN 197
            .|||.||.|:|...||.||||:..||||||||.:....|||||||||...|||||.:| .:.:|.
Mouse   165 VLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRR-HDSVIT 228

  Fly   198 IVVASRLVYRKGIDLLAGIIPRF-KNTPNINFIIVGDGPKRDLLEEIREKTNMQERVQMVGAVEH 261
            :||.||||||||.|||:||||.. :....::|:|.|:||||.:|||:||:..:.:|||::||:||
Mouse   229 VVVVSRLVYRKGTDLLSGIIPELCQKYQELHFLIGGEGPKRIILEEVRERYQLHDRVQLLGALEH 293

  Fly   262 NRVRDFLVRGHIFLNTSLTEAYCMAIVEAASCGLQVVSTSVGGIPEVLPKSLILLAEPEIDAIYA 326
            ..||:.||:||||||||||||:|||||||||||||||||.|||||||||:|||:|.||.:.::  
Mouse   294 KDVRNVLVQGHIFLNTSLTEAFCMAIVEAASCGLQVVSTKVGGIPEVLPESLIILCEPSVKSL-- 356

  Fly   327 AILIAIDRHRKSSFKVSPSVGNGHLASDANGKVKRRRRRKVDTPISPTQLPAVSAPPADQNSSTE 391
                 .|...|:.|:|....                             |||             
Mouse   357 -----CDGLEKAIFQVKSGT-----------------------------LPA------------- 374

  Fly   392 PVMCPYRCNELVETLYNWEDVALRTVKVYDRVLNERSFTTSELVFAVWQH-----GSWFLVFFVV 451
                |...:.:|:|.|.|.:||.||.|||:||..|......:.:..:..|     |..|.:..|:
Mouse   375 ----PENIHNVVKTFYTWRNVAERTEKVYERVSKETVLPMHKRLDRLISHCGPVTGYMFALLAVL 435

  Fly   452 AHFLMRLLELWRPRKHVEIAQDV--QRRA 478
            ::..:..|:...|...:::|.|.  .|||
Mouse   436 SYLFLIFLQWMTPDSFIDVAIDATGPRRA 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 189/307 (62%)
GT1_PIG-A_like 2..451 CDD:99970 223/454 (49%)
PigaNP_035211.2 GT1_PIG-A_like 34..433 CDD:99970 222/452 (49%)
RfaB 34..405 CDD:223515 218/424 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150835932
eggNOG 1 0.900 E1_COG0438
Hieranoid 1 1.000
Homologene 1 1.000 H1982
Inparanoid 1 1.050 416 1.000 Inparanoid score I1803
Isobase 1 0.950 0 Normalized mean entropy S691
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004176
OrthoInspector 1 1.000 T1083007
orthoMCL 1 0.900 OOG5_127105
Panther 1 1.100 LDO PTHR45871
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R517
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.