DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-A and piga-1

Sequence 1:NP_001286547.1 Gene:PIG-A FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_495840.1 Gene:piga-1 WormBaseID:WBGene00008431 Length:444 Species:Caenorhabditis elegans

Alignment Length:473 Identity:214/474 (45%)
Similarity:283/474 (60%) Gaps:62/474 (13%)


  Fly     3 ICMVSDFFYPSIGGVEEHVYNLSQMLLSLGHKIVVLTHAYGDCSGIRYVTGYLKVYYLPIKVCYN 67
            |.:|||||.|:.||||.|:|.|:|.|:.|||::||:||.||:..||||::..|||||||..|.||
 Worm    10 IALVSDFFCPNAGGVETHIYFLAQCLIELGHRVVVITHGYGNRKGIRYLSNGLKVYYLPFIVAYN 74

  Fly    68 QCILPTAVCNVPMLRAVLLRERVEVVHGHSAFSALAHEALMVGSLLGLKTVFTDHSLFGFADLSA 132
            ...|.:.|.::|.||.|||||.|:::||||.||:||||.||:|.|:||:|||||||||||||.||
 Worm    75 GATLGSIVGSMPWLRKVLLRENVQIIHGHSTFSSLAHETLMIGGLMGLRTVFTDHSLFGFADASA 139

  Fly   133 ALTNNL-LEVNLGMVNHAICVSHIGKENTVLRARVAKHRVSVIPNAVDTALFTPDPQQRPSNDII 196
            .|||.| |:.:|..|:..||||:..|||||||.::..::||.||||::|:|||||..|. .|:..
 Worm   140 ILTNKLVLQYSLINVDQTICVSYTSKENTVLRGKLDPNKVSTIPNAIETSLFTPDRNQF-FNNPT 203

  Fly   197 NIVVASRLVYRKGIDLLAGIIPRF-KNTPNINFIIVGDGPKRDLLEEIREKTNMQERVQMVGAVE 260
            .||...|||||||.|||..|:|:. ....::.|||.||||||..|||:.|:..:.|||.::|.:.
 Worm   204 TIVFLGRLVYRKGADLLCEIVPKVCARHKSVRFIIGGDGPKRIELEEMLERFKLHERVVILGMLP 268

  Fly   261 HNRVRDFLVRGHIFLNTSLTEAYCMAIVEAASCGLQVVSTSVGGIPEVLP-KSLILLAEPEIDAI 324
            ||:|:..|.:|.||:|||||||:||:|||||||||.||||.|||:||||| ...|.|.||..|.:
 Worm   269 HNQVKRVLNQGQIFINTSLTEAFCMSIVEAASCGLHVVSTRVGGVPEVLPIGEFISLEEPVPDDL 333

  Fly   325 YAAILIAIDRHRKSSFKVSPSVGNGHLASDANGKVKRRRRRKVDTPISPTQLPAVSAPPADQNSS 389
            ..|:|.|:||..|..                                                  
 Worm   334 VDALLKAVDRREKGL-------------------------------------------------- 348

  Fly   390 TEPVMCPYRCNELVETLYNWEDVALRTVKVYDRVLNERSFTTSELVFAVWQHGSWFLVFFVVAH- 453
               :|.|...:|.|..:|||.|||.||..:|.:.:..........:...:..|..|.:.::|.. 
 Worm   349 ---LMDPTEKHEAVSKMYNWPDVAARTQVIYQKAVESEPTGRLGRLKGYYDQGIGFGIMYIVVSC 410

  Fly   454 ---FLMRLLELW-RPRKH 467
               |.:.:|:|: .|||:
 Worm   411 IIIFWLTVLDLFDSPRKN 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 179/308 (58%)
GT1_PIG-A_like 2..451 CDD:99970 207/451 (46%)
piga-1NP_495840.1 GT1_PIG-A_like 9..409 CDD:99970 208/453 (46%)
RfaB 10..383 CDD:223515 205/427 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150351582
eggNOG 1 0.900 E1_COG0438
Hieranoid 1 1.000
Homologene 1 1.000 H1982
Inparanoid 1 1.050 367 1.000 Inparanoid score I1243
Isobase 1 0.950 0 Normalized mean entropy S691
OMA 1 1.010
OrthoDB 1 1.010 D305260at33208
OrthoFinder 1 1.000 FOG0004176
OrthoInspector 1 1.000 T476743
orthoMCL 1 0.900 OOG5_127105
Panther 1 1.100 LDO PTHR45871
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R517
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.