DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-A and algn-2

Sequence 1:NP_001286547.1 Gene:PIG-A FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_495010.2 Gene:algn-2 WormBaseID:WBGene00017282 Length:400 Species:Caenorhabditis elegans

Alignment Length:344 Identity:64/345 (19%)
Similarity:124/345 (36%) Gaps:76/345 (22%)


  Fly    14 IGGVEEHVYNLSQMLLSLGHKIVVLTHAYGDCSGIRYVTGYLKVYYLPIKVCYNQCILP------ 72
            |||.|..:.:.:..|...||.:.:.|:.|......:..        |.:.:|   .::|      
 Worm    13 IGGAERLIVDAAVGLQDRGHSVRIFTNQYSRSHCFQET--------LDLDIC---TVVPWIPRSI 66

  Fly    73 ----TAVCN-----VPMLRAVLLRERVEVVHGHSAFSA---LAHEALMVGSLLGLKTVFTDHSLF 125
                .|:|.     :..|..|:..:..:|:...|..::   |.|       ....|.||..|   
 Worm    67 FGKGHALCAYLKMIIAALYIVIYHKDTDVILSDSVSASQFVLRH-------FSKAKLVFYCH--- 121

  Fly   126 GFADL--------SAALTNNLL----EVNLGMVNHAICVSHIGKENTVLRA--RVAKHRVSVIPN 176
             |.|.        ..|...|::    |...|:.: .|||:....:|.|...  .:|...::|:..
 Worm   122 -FPDRLLTKRDGNLKAFYRNIIDWIEEYTTGLAD-VICVNSNFTKNVVRETFKSLASQELTVLYP 184

  Fly   177 AVDTALF-----TPD-PQQRPSNDIINIVVASRLVYRKGIDLLAGIIPRFK-NTPNINF----II 230
            :::|..|     :.| .::.|..........:|...:|.|.|......:.| |.|...|    ::
 Worm   185 SLNTEFFDSIEASDDFGEEIPRGTKYVFTSLNRFERKKNIVLALDAFEKLKSNLPADEFSQCHLV 249

  Fly   231 VGDG-----PKR-----DLLEEIREKTNMQERVQMVGAVEHNRVRDFLVRGHIFLNTSLTEAYCM 285
            :..|     |:.     :|:|.:::.....:::..:.:....:..:.:.|....|.|...|.:.:
 Worm   250 IAGGYDLKNPENIEHYDELVEHMKKLELPADQIVFLHSPSDTQKVNLIRRSRAVLYTPDREHFGI 314

  Fly   286 AIVEAASCGLQVVSTSVGG 304
            ..|||...|..|::.:.||
 Worm   315 VPVEAMYLGTPVIAVNTGG 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 64/345 (19%)
GT1_PIG-A_like 2..451 CDD:99970 64/345 (19%)
algn-2NP_495010.2 RfaB 1..400 CDD:223515 64/345 (19%)
GT1_ALG2_like 2..392 CDD:99977 64/345 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.