DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-A and piga

Sequence 1:NP_001286547.1 Gene:PIG-A FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_002942607.2 Gene:piga XenbaseID:XB-GENE-996765 Length:492 Species:Xenopus tropicalis

Alignment Length:477 Identity:230/478 (48%)
Similarity:301/478 (63%) Gaps:62/478 (13%)


  Fly     3 ICMVSDFFYPSIGGVEEHVYNLSQMLLSLGHKIVVLTHAYGDCSGIRYVTGYLKVYYLPIKVCYN 67
            ||||||||||::||||.|:|.|||.|:..|||::::||||||..||||:|..|||||||:||.||
 Frog    29 ICMVSDFFYPNVGGVESHIYQLSQCLIERGHKVIIVTHAYGDRKGIRYLTNGLKVYYLPLKVMYN 93

  Fly    68 QCILPTAVCNVPMLRAVLLRERVEVVHGHSAFSALAHEALMVGSLLGLKTVFTDHSLFGFADLSA 132
            |....|.:.::|:||.:.:||||.|:|.||:|||:||:||.....:||.|||||||||||||:|:
 Frog    94 QSTATTLLHSLPLLRFIFVRERVSVIHSHSSFSAMAHDALFHAKTMGLHTVFTDHSLFGFADVSS 158

  Fly   133 ALTNNLLEVNLGMVNHAICVSHIGKENTVLRARVAKHRVSVIPNAVDTALFTPDPQQRPSNDIIN 197
            .|||.||.|:|...||.||||:..||||||||.:....|||||||:|...|||||:.| ....|.
 Frog   159 VLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAIDPTDFTPDPKIR-DRSRIT 222

  Fly   198 IVVASRLVYRKGIDLLAGIIPRF-KNTPNINFIIVGDGPKRDLLEEIREKTNMQERVQMVGAVEH 261
            :||.||||||||||||.||||.. :..||::|||.|:||||.:|||:||:..:.:||:::||:||
 Frog   223 VVVVSRLVYRKGIDLLGGIIPEMCQRYPNLHFIIGGEGPKRIILEEVRERYQLHDRVRLLGALEH 287

  Fly   262 NRVRDFLVRGHIFLNTSLTEAYCMAIVEAASCGLQVVSTSVGGIPEVLPKSLILLAEPEIDAIYA 326
            .:||:.||:|.||||||||||:||||||.||||||||||.|||||||||::.|:|.:|.:.::.:
 Frog   288 QQVRNVLVQGDIFLNTSLTEAFCMAIVEGASCGLQVVSTRVGGIPEVLPENFIILCKPSVKSLCS 352

  Fly   327 AILIAIDRHRKSSFKVSPSVGNGHLASDANGKVKRRRRRKVDTPISPTQLPAVSAPPADQNSSTE 391
            .:..||:|               .||.:                                     
 Frog   353 GLEQAINR---------------LLAGE------------------------------------- 365

  Fly   392 PVMCPYRCNELVETLYNWEDVALRTVK--VYDRVLNERSFTTSELVFAVWQH-----GSWFLVFF 449
             ::.|...:..|.|.|.|.|||.||.|  ||:||..|......:.:..:.:|     |..|.:|.
 Frog   366 -LLSPETIHRTVSTFYTWRDVAERTEKVCVYNRVAQEVVLPMDQRLERLVRHCGVVTGCIFALFA 429

  Fly   450 VVAHFLMRLLELWRPRKHVEIA 471
            :|:..|:..|....|...::||
 Frog   430 IVSFLLLNFLRWMTPDSSIDIA 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 194/307 (63%)
GT1_PIG-A_like 2..451 CDD:99970 224/456 (49%)
pigaXP_002942607.2 GT1_PIG-A_like 28..429 CDD:99970 224/454 (49%)
RfaB 29..401 CDD:223515 219/426 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150837554
eggNOG 1 0.900 E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H1982
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D305260at33208
OrthoFinder 1 1.000 FOG0004176
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.