DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4975 and MEE50

Sequence 1:NP_001137693.2 Gene:CG4975 FlyBaseID:FBgn0034266 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_567156.1 Gene:MEE50 AraportID:AT4G00231 Length:475 Species:Arabidopsis thaliana

Alignment Length:490 Identity:99/491 (20%)
Similarity:167/491 (34%) Gaps:129/491 (26%)


  Fly     9 KELVHKLVRLSITENEEEISALLKN-LRLLL--TKGRENQETLAESAEFSSFLNAVAFSPVMRTE 70
            :|::..|:..|      ::|..|:: |:.||  :|....:..||..:...|.|..:...|...:.
plant     7 EEVLQPLLHAS------DLSYSLEDCLKFLLESSKTDSGRSDLASKSILPSILRLLQLLPYPSSR 65

  Fly    71 HRLIHNLSLQVLANSVVNNETTQALIWSQHGLKIAEQAYASPLGSSNNVL--LMIMYNIYISGHG 133
            |.|  ||||:||.|......:.|.......|..|......|.:.....|.  |.::.|:.:.|. 
plant    66 HYL--NLSLKVLRNLCAGEVSNQNSFVDHDGSAIVSDLLDSAIADFETVRFGLQVLANVVLFGE- 127

  Fly   134 LITDLVALKTCLQLWRALNEAQCTYNFEYLHFFLEHFIVQNGRACVACYQKLETEDRVAFLDY-- 196
                    |....:|              |.|:.|.|:      .:|..:|.||.|.:..:.|  
plant   128 --------KRQRDVW--------------LRFYPERFL------SIAKIRKRETFDPLCMILYTC 164

  Fly   197 -------------------VAHYLRENSPNGDVTLFLLQHFAKEFRMKSDCLLRETIKL----KH 238
                               :|..||.:|..|.|..:.|:.......::....|:...||    ::
plant   165 VDGSSEIASELCSCQGLTIIAETLRTSSSVGSVEDYWLKLLVSRICVEDGYFLKLFSKLYEDAEN 229

  Fly   239 ELHPREVHTLLRIIASASGSEKYANV-YPNDQ----------------------------SLFIN 274
            |:...|...|:|:::..: :|:...| .|.|.                            |..::
plant   230 EIFSSEQAFLVRMVSDIA-NERIGKVSIPKDTACSILGLFRQSVDVFDFVSGERSELPTGSTIVD 293

  Fly   275 VSS----LLRCIVSAGK-------EPDGGG--------------------LDKPMTKLEEVALTS 308
            |..    ::|...:.|:       ..|.|.                    ||.|.|..:.:..:.
plant   294 VMGYSLVIIRDACAGGRLEELKEDNKDSGDTVELLLSSGLIELLLDLLSKLDPPTTIKKALNQSP 358

  Fly   309 DIDAGYEKKVSYE-LKTLLVRCSANLLYDNKANKGYCLDTQLLPTLLECTTMDARNPLMREWSIL 372
            ...:...|...|. .:..:|....|..|..|..:....:...|..:|:....|..||.:|||.:.
plant   359 SSSSSSLKPCPYRGFRRDIVSVIGNCAYRRKEVQDEIRERDGLFLMLQQCVTDDENPFLREWGLW 423

  Fly   373 AIRNACINCPEAQQVIAGLTMQGSAPNDILTELNL 407
            .|||.....||.|:|:|.|.::||.....|.|:.|
plant   424 CIRNLLEGNPENQEVVAELEIKGSVDVPQLREIGL 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4975NP_001137693.2 Atx10homo_assoc 322..408 CDD:286802 26/87 (30%)
MEE50NP_567156.1 Atx10homo_assoc 373..472 CDD:286802 26/87 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131727
Panther 1 1.100 LDO PTHR13255
Phylome 1 0.910 0.667 Consistency score
32.910

Return to query results.
Submit another query.