DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4975 and mug160

Sequence 1:NP_001137693.2 Gene:CG4975 FlyBaseID:FBgn0034266 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_588219.2 Gene:mug160 PomBaseID:SPCC584.14 Length:434 Species:Schizosaccharomyces pombe

Alignment Length:475 Identity:104/476 (22%)
Similarity:164/476 (34%) Gaps:142/476 (30%)


  Fly     5 KSETKELVHKLVRLSITENEEEISALLKNLRLLLTKGRENQETLAESAEFSSFLNAVAFSPVMRT 69
            |.|:.|....|  ||.:.|.:|::  :|.:|..|.||.::|:...::..:|.||      |...|
pombe     3 KMESTEEWEAL--LSSSSNGDELT--MKLIRNGLAKGFKSQKAAGDAGLYSRFL------PYHFT 57

  Fly    70 E---HRLIHNLSLQVLANSVVNNETTQALIWSQHGLKIAEQAYASPLGSSNNVLLMIMYNIYISG 131
            |   :....:|..|:.||||..|...|...|:                     .||...:.::. 
pombe    58 ESVSNDSFSSLPWQIFANSVAGNSPLQNEAWA---------------------FLMDNEDFFLP- 100

  Fly   132 HGLITDLVALKTCLQLWRALNEAQCTYNFEYLHFFLEHFI-VQNGRACVACYQKLETEDRVAFLD 195
                             ..:|.||||    .|...|...| |.:.|....|:.|..........|
pombe   101 -----------------VPMNPAQCT----ALEIALWSLIRVDDQRLFELCHSKSGIRLLSIIFD 144

  Fly   196 YVAH--YLRE-------------NSPNGDVTL----------FLLQHFAKEFRMKS--------- 226
            :.:|  :|||             |.||..|.:          ||:...:.:.::|.         
pombe   145 FDSHPDWLREDVMFNIAERILKSNFPNVLVNVASKIGPKSIYFLIDCMSHKIKLKETATGFYVIL 209

  Fly   227 ---DCLLRETIKLKHELHPREVHTLLRIIASASGSEKYANVYPNDQSLFINVSSLLRCIVS---- 284
               .|:.|:...:..|...:|:        |::|.: :.|.:  .:.:.:.|..|.|..||    
pombe   210 DVLSCVGRQFASVLEECFTKEI--------SSAGLD-HINHF--SEIVMLGVDLLYRDYVSYDTT 263

  Fly   285 -AGKEPDGGGL-------DKPMTKLEEVA-LTSDIDAGYEKKVSYELKTLLVRCSANLLYDNKAN 340
             :.|..|...|       .:|.:.:.|:. |.:.:|....||...| ||.........||:  |.
pombe   264 ISLKNDDSSSLGDMEFETSQPSSSISEIIHLLAVLDKRIPKKTLVE-KTYASSMELQELYN--AV 325

  Fly   341 KG-----------YCLDTQLLPTL----------LECTTMDARNPLMREWSILAIRNACINCPEA 384
            .|           .|......|.|          :.....|..||.:||.|:|..|....|..|.
pombe   326 VGVKRECVRFIAFICSKFSTAPDLVRHFNGVALIISQANYDDWNPYIREISVLCTRLLLQNNIEN 390

  Fly   385 QQVIAGLTMQGSAPNDILTE 404
            |::|.|||...:..:|.|.|
pombe   391 QKIIGGLTPITTTHSDALEE 410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4975NP_001137693.2 Atx10homo_assoc 322..408 CDD:286802 27/105 (26%)
mug160NP_588219.2 Atx10homo_assoc 328..426 CDD:286802 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131727
Panther 1 1.100 LDO PTHR13255
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R770
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.