DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and CDY1

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_004671.1 Gene:CDY1 / 9085 HGNCID:1809 Length:554 Species:Homo sapiens


Alignment Length:64 Identity:23/64 - (35%)
Similarity:34/64 - (53%) Gaps:3/64 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SSEYIVEKFLGKRY-LRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKK 81
            |.|:.||..:.||. ..|..|||.:|:||..:..||||.::|..|...:.|:...  |..::||
Human     3 SQEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDFNRR--QTEKQKK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 19/50 (38%)
CDY1NP_004671.1 CD_CDY 5..56 CDD:349284 19/50 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..106
crotonase-like 286..482 CDD:119339
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.