DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and Mphosph8

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001347001.1 Gene:Mphosph8 / 75339 MGIID:1922589 Length:870 Species:Mus musculus


Alignment Length:59 Identity:18/59 - (30%)
Similarity:31/59 - (52%) Gaps:2/59 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EKSSE--YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAEL 73
            |:..|  :.||:.|..:...|:..|..:|:||..|..||||..:|..|..::.::..:|
Mouse    52 EEDGEDVFEVERILDMKCEGGKNLYKVRWKGYTSEDDTWEPEVHLEDCKEVLLEFRKKL 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 16/51 (31%)
Mphosph8NP_001347001.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..55 1/2 (50%)
CD_MMP8 58..108 CDD:349283 15/49 (31%)
Histone H3K9me3 binding. /evidence=ECO:0000250|UniProtKB:Q99549 80..87 3/6 (50%)
PTZ00121 <97..482 CDD:173412 2/14 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..175
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..234
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..300
ANKYR <553..734 CDD:440430
ANK 1 610..639
ANK repeat 613..641 CDD:293786
ANK repeat 643..674 CDD:293786
ANK 2 643..672
ANK repeat 676..705 CDD:293786
ANK 3 676..705
ANK 4 709..738
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.