| Sequence 1: | NP_611240.1 | Gene: | Oxp / 37002 | FlyBaseID: | FBgn0034255 | Length: | 84 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001347001.1 | Gene: | Mphosph8 / 75339 | MGIID: | 1922589 | Length: | 870 | Species: | Mus musculus |
| Alignment Length: | 59 | Identity: | 18/59 - (30%) |
|---|---|---|---|
| Similarity: | 31/59 - (52%) | Gaps: | 2/59 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 17 EKSSE--YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAEL 73 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Oxp | NP_611240.1 | CD_Rhino | 21..71 | CDD:349280 | 16/51 (31%) |
| Mphosph8 | NP_001347001.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 18..55 | 1/2 (50%) | |
| CD_MMP8 | 58..108 | CDD:349283 | 15/49 (31%) | ||
| Histone H3K9me3 binding. /evidence=ECO:0000250|UniProtKB:Q99549 | 80..87 | 3/6 (50%) | |||
| PTZ00121 | <97..482 | CDD:173412 | 2/14 (14%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 129..175 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 209..234 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 250..300 | ||||
| ANKYR | <553..734 | CDD:440430 | |||
| ANK 1 | 610..639 | ||||
| ANK repeat | 613..641 | CDD:293786 | |||
| ANK repeat | 643..674 | CDD:293786 | |||
| ANK 2 | 643..672 | ||||
| ANK repeat | 676..705 | CDD:293786 | |||
| ANK 3 | 676..705 | ||||
| ANK 4 | 709..738 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||