DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cdyl

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_696879.5 Gene:cdyl / 568457 ZFINID:ZDB-GENE-070912-561 Length:581 Species:Danio rerio


Alignment Length:63 Identity:24/63 - (38%)
Similarity:36/63 - (57%) Gaps:5/63 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YIVEKFLGKR-YLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKKND 83
            |.||:.:||| ..:|:.:||.:|.||..|..||||..:|..|:..|.::.    :|..||:.|
Zfish     8 YEVERIIGKRKNKKGKTEYLVRWRGYSFEGDTWEPEGHLSSCIEFIHEFN----RQHSEKQKD 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 20/49 (41%)
cdylXP_696879.5 CD_CDY 7..58 CDD:349284 20/53 (38%)
Herpes_BLLF1 <73..297 CDD:282904
crotonase-like 327..523 CDD:119339
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.