DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and mphosph8

DIOPT Version :8

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001119905.1 Gene:mphosph8 / 504061 ZFINID:ZDB-GENE-050309-191 Length:946 Species:Danio rerio

Alignment Length:66 Identity:18/67 (27%)
Similarity:32/67 (48%) Gaps:0/67 (0%)


  Fly    16 KEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREK 80
            :::...|.||:.:..|...|...|..:|:.|..|..||||..:|..|..::..|:..|.:...:|
Zfish    15 QDEEDVYEVERIIDVRVEEGEVLYRVRWKNYSSEDDTWEPEAHLDDCKEVLLAYKKALAELKPKK 79

  Fly    81 K 81
            :
Zfish    80 E 80

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 16/51 (31%)
mphosph8NP_001119905.1 CHROMO 20..70 CDD:214605 16/50 (32%)
ANK repeat 654..684 CDD:293786
ANK 681..805 CDD:238125
Ank_2 693..781 CDD:289560
ANK repeat 719..750 CDD:293786
ANK repeat 752..781 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.