powered by:
Protein Alignment Oxp and cbx7
DIOPT Version :8
Sequence 1: | NP_611240.1 |
Gene: | Oxp / 37002 |
FlyBaseID: | FBgn0034255 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001005071.1 |
Gene: | cbx7 / 448638 |
XenbaseID: | XB-GENE-942584 |
Length: | 245 |
Species: | Xenopus tropicalis |
Alignment Length: | 60 |
Identity: | 21/61 (34%) |
Similarity: | 32/61 (52%) |
Gaps: | 7/61 (11%) |
Fly 22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKK 81
:.||....||..:|:.:||.||:|:|.:..||||.|: |.|....|..:.:|:|
Frog 11 FAVESIRKKRIRKGKVEYLVKWKGWPPKYSTWEPEEH-------ILDPRLVLAYEEKEEK 63
|
Known Domains:
Gene | Sequence | Domain | Region |
External ID | Identity |
Oxp | NP_611240.1 |
CHROMO |
21..72 |
CDD:237991 |
18/50 (36%) |
cbx7 | NP_001005071.1 |
Chromo |
11..60 |
CDD:306815 |
19/56 (34%) |
CBX7_C |
202..234 |
CDD:319236 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
|
|
|
D1628171at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.