DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cbx7

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001005071.1 Gene:cbx7 / 448638 XenbaseID:XB-GENE-942584 Length:245 Species:Xenopus tropicalis


Alignment Length:60 Identity:21/60 - (35%)
Similarity:32/60 - (53%) Gaps:7/60 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKK 81
            :.||....||..:|:.:||.||:|:|.:..||||.|:       |.|....|..:.:|:|
 Frog    11 FAVESIRKKRIRKGKVEYLVKWKGWPPKYSTWEPEEH-------ILDPRLVLAYEEKEEK 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 18/48 (38%)
cbx7NP_001005071.1 CD_Cbx7 7..62 CDD:349293 19/57 (33%)
CBX7_C 202..234 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.