DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cbx7

DIOPT Version :8

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001005071.1 Gene:cbx7 / 448638 XenbaseID:XB-GENE-942584 Length:245 Species:Xenopus tropicalis

Alignment Length:60 Identity:21/61 (34%)
Similarity:32/61 (52%) Gaps:7/61 (11%)


  Fly    22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKK 81
            :.||....||..:|:.:||.||:|:|.:..||||.|:       |.|....|..:.:|:|
 Frog    11 FAVESIRKKRIRKGKVEYLVKWKGWPPKYSTWEPEEH-------ILDPRLVLAYEEKEEK 63

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 18/50 (36%)
cbx7NP_001005071.1 Chromo 11..60 CDD:306815 19/56 (34%)
CBX7_C 202..234 CDD:319236
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.