DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and Su(var)205

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster


Alignment Length:77 Identity:31/77 - (40%)
Similarity:44/77 - (57%) Gaps:7/77 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRNVKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQ 76
            |.:.:|:..||.|||.:.:|..:|:.:|..||:|||..:.||||..|| .|..||..|||.  ::
  Fly    14 VSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNL-DCQDLIQQYEAS--RK 75

  Fly    77 SREK----KNDQ 84
            ..||    |.|:
  Fly    76 DEEKSAASKKDR 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 23/49 (47%)
Su(var)205NP_476755.1 CD_HP1a_insect 24..72 CDD:349300 22/48 (46%)
CSD_HP1a_insect 146..198 CDD:349305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.