DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and Su(var)205

DIOPT Version :8

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster

Alignment Length:77 Identity:31/78 (40%)
Similarity:44/78 (56%) Gaps:7/78 (9%)


  Fly    12 VRNVKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQ 76
            |.:.:|:..||.|||.:.:|..:|:.:|..||:|||..:.||||..|| .|..||..|||.  ::
  Fly    14 VSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNL-DCQDLIQQYEAS--RK 75

  Fly    77 SREK----KNDQ 84
            ..||    |.|:
  Fly    76 DEEKSAASKKDR 87

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 25/51 (49%)
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 23/49 (47%)
ChSh 141..202 CDD:197638
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1628171at2759
OrthoFinder 1 1.000 FOG0000276
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22812
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.