DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and CG8289

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster


Alignment Length:69 Identity:19/69 - (27%)
Similarity:30/69 - (43%) Gaps:9/69 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GLGVRNVKEKSS--------EYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTL 65
            |.|.||...|.:        ::.|||.|.....:....:..:|:.|..:..:|||.:||. |..|
  Fly   212 GRGRRNAGTKKADDSIDPEKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLA-CDAL 275

  Fly    66 IADY 69
            |..:
  Fly   276 IEKF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 14/49 (29%)
CG8289NP_573229.1 CD_CSD 233..281 CDD:349274 14/48 (29%)

Return to query results.
Submit another query.