DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Oxp and Cbx3

DIOPT Version :9

Sequence 1:	NP_611240.1	Gene:	Oxp / 37002	FlyBaseID:	FBgn0034255	Length:	84	Species:	Drosophila melanogaster
Sequence 2:	NP_001008314.2	Gene:	Cbx3 / 297093	RGDID:	1549705	Length:	183	Species:	Rattus norvegicus

Alignment Length:	72	Identity:	29/72 - (40%)
Similarity:	41/72 - (56%)	Gaps:	5/72 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    13 RNVKE-KSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQ 76
            :.|:| :..|::|||.|.:|.:.|:.:|..||:|:.....||||.||| .|..||   ||.|..|
  Rat    20 KKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENL-DCPELI---EAFLNSQ 80

  Fly    77 SREKKND 83
            ...|:.|
  Rat    81 KAGKEKD 87

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Oxp	NP_611240.1	CHROMO	21..72	CDD:237991	22/50 (44%)
Cbx3	NP_001008314.2	CD_HP1gamma_Cbx3	29..78	CDD:349299	23/52 (44%)
Cbx3	NP_001008314.2	CSD_HP1gamma_Cbx3	116..173	CDD:349303
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1911
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	3.820