DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and Cbx3

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001008314.2 Gene:Cbx3 / 297093 RGDID:1549705 Length:183 Species:Rattus norvegicus


Alignment Length:72 Identity:29/72 - (40%)
Similarity:41/72 - (56%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RNVKE-KSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQ 76
            :.|:| :..|::|||.|.:|.:.|:.:|..||:|:.....||||.||| .|..||   ||.|..|
  Rat    20 KKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENL-DCPELI---EAFLNSQ 80

  Fly    77 SREKKND 83
            ...|:.|
  Rat    81 KAGKEKD 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 21/49 (43%)
Cbx3NP_001008314.2 CD_HP1gamma_Cbx3 29..78 CDD:349299 23/52 (44%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.