| Sequence 1: | NP_611240.1 | Gene: | Oxp / 37002 | FlyBaseID: | FBgn0034255 | Length: | 84 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_783640.1 | Gene: | CBX7 / 23492 | HGNCID: | 1557 | Length: | 251 | Species: | Homo sapiens |
| Alignment Length: | 38 | Identity: | 16/38 - (42%) |
|---|---|---|---|
| Similarity: | 25/38 - (65%) | Gaps: | 0/38 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENL 59 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Oxp | NP_611240.1 | CD_Rhino | 21..71 | CDD:349280 | 16/38 (42%) |
| CBX7 | NP_783640.1 | CD_Cbx7 | 7..62 | CDD:349293 | 16/38 (42%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 190..220 | ||||
| CBX7_C | 209..240 | CDD:465385 | |||
| Required for cellular lifespan extension | 223..236 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||