DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and CBX7

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_783640.1 Gene:CBX7 / 23492 HGNCID:1557 Length:251 Species:Homo sapiens


Alignment Length:38 Identity:16/38 - (42%)
Similarity:25/38 - (65%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENL 59
            :.||....||..:|:.:||.||:|:|.:..||||.|::
Human    11 FAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHI 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 16/38 (42%)
CBX7NP_783640.1 CD_Cbx7 7..62 CDD:349293 16/38 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..220
CBX7_C 209..240 CDD:465385
Required for cellular lifespan extension 223..236
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.