DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and CBX6

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_055107.3 Gene:CBX6 / 23466 HGNCID:1556 Length:412 Species:Homo sapiens


Alignment Length:60 Identity:23/60 - (38%)
Similarity:36/60 - (60%) Gaps:5/60 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKK 81
            :..|..:.:|..:||.:||.||:|:.|:..||||.||: ....|||.:|    |:.||::
Human    11 FAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENI-LDSRLIAAFE----QKERERE 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 19/48 (40%)
CBX6NP_055107.3 CD_Cbx6 8..65 CDD:349295 23/58 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..152
PRK12323 <237..>331 CDD:481241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..364
CBX7_C 357..388 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.