DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and hpl-1

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_510199.1 Gene:hpl-1 / 181450 WormBaseID:WBGene00001995 Length:184 Species:Caenorhabditis elegans


Alignment Length:66 Identity:27/66 - (40%)
Similarity:44/66 - (66%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREK 80
            :..|:.::|||.|.||..||..:|..||:|:|..:|:|||:||| :|..:|.:||.|..:::..|
 Worm    31 ESSSNVFVVEKVLNKRLTRGGSEYYIKWQGFPESECSWEPIENL-QCDRMIQEYEKEAAKRTTRK 94

  Fly    81 K 81
            :
 Worm    95 R 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 23/49 (47%)
hpl-1NP_510199.1 CD_HP1_like 36..85 CDD:349316 23/49 (47%)
ChSh 114..174 CDD:197638
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.