DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cec-3

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_495652.1 Gene:cec-3 / 174265 WormBaseID:WBGene00011636 Length:339 Species:Caenorhabditis elegans


Alignment Length:77 Identity:25/77 - (32%)
Similarity:39/77 - (50%) Gaps:12/77 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KSSE-YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMT-LIADY--------EAE 72
            ||.| :.|||.|..:..........:|.||..::.||||.|:|.:|.: ::|:|        :.|
 Worm    19 KSDEIFEVEKILAHKVTDNLLVLQVRWLGYGADEDTWEPEEDLQECASEVVAEYYKKLKVTDKTE 83

  Fly    73 LFQ--QSREKKN 82
            |.:  |.:.|||
 Worm    84 LIELLQKQIKKN 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 17/59 (29%)
cec-3NP_495652.1 CD_CSD 24..74 CDD:349274 16/49 (33%)

Return to query results.
Submit another query.