powered by:
Protein Alignment Oxp and HP1Lcsd
DIOPT Version :8
Sequence 1: | NP_611240.1 |
Gene: | Oxp / 37002 |
FlyBaseID: | FBgn0034255 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001246478.1 |
Gene: | HP1Lcsd / 12798145 |
FlyBaseID: | FBgn0263084 |
Length: | 83 |
Species: | Drosophila melanogaster |
Alignment Length: | 32 |
Identity: | 6/33 (18%) |
Similarity: | 12/33 (36%) |
Gaps: | 15/33 (45%) |
Fly 32 YLRGR---------------PQYLTKWEGYPI 48
::||| ..:|.|::..|:
Fly 6 FVRGRMVEKIVYVFTTANKNTMFLIKFKDSPV 37
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
|
|
|
FOG0000276 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.