DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and HP1Lcsd

DIOPT Version :8

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001246478.1 Gene:HP1Lcsd / 12798145 FlyBaseID:FBgn0263084 Length:83 Species:Drosophila melanogaster

Alignment Length:32 Identity:6/33 (18%)
Similarity:12/33 (36%) Gaps:15/33 (45%)


  Fly    32 YLRGR---------------PQYLTKWEGYPI 48
            ::|||               ..:|.|::..|:
  Fly     6 FVRGRMVEKIVYVFTTANKNTMFLIKFKDSPV 37

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 6/33 (18%)
HP1LcsdNP_001246478.1 Chromo_shadow 12..63 CDD:279701 3/27 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000276
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.