DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and CBX3

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_009207.2 Gene:CBX3 / 11335 HGNCID:1553 Length:183 Species:Homo sapiens


Alignment Length:72 Identity:29/72 - (40%)
Similarity:41/72 - (56%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RNVKE-KSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQ 76
            :.|:| :..|::|||.|.:|.:.|:.:|..||:|:.....||||.||| .|..||   ||.|..|
Human    20 KKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENL-DCPELI---EAFLNSQ 80

  Fly    77 SREKKND 83
            ...|:.|
Human    81 KAGKEKD 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 21/49 (43%)
CBX3NP_009207.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 2/7 (29%)
CD_HP1gamma_Cbx3 29..78 CDD:349299 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..125 3/9 (33%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.