DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and CBX3

DIOPT Version :9

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_009207.2 Gene:CBX3 / 11335 HGNCID:1553 Length:183 Species:Homo sapiens


Alignment Length:72 Identity:29/72 - (40%)
Similarity:41/72 - (56%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RNVKE-KSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQ 76
            :.|:| :..|::|||.|.:|.:.|:.:|..||:|:.....||||.||| .|..||   ||.|..|
Human    20 KKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENL-DCPELI---EAFLNSQ 80

  Fly    77 SREKKND 83
            ...|:.|
Human    81 KAGKEKD 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CHROMO 21..72 CDD:237991 22/50 (44%)
CBX3NP_009207.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 2/7 (29%)
CD_HP1gamma_Cbx3 29..78 CDD:349299 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..125 3/9 (33%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.