DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cbx8a

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_991179.2 Gene:cbx8a / 100150672 ZFINID:ZDB-GENE-040405-1 Length:342 Species:Danio rerio


Alignment Length:63 Identity:19/63 - (30%)
Similarity:32/63 - (50%) Gaps:9/63 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKKNDQ 84
            :..|..:.:|..|||.:||.||:|:..:..||||.||:         .:..||....|::.::
Zfish    11 FAAESIIKRRIRRGRMEYLVKWKGWSQKYSTWEPEENI---------LDERLFAAFEERERER 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 16/48 (33%)
cbx8aNP_991179.2 CD_CSD 7..57 CDD:475127 18/54 (33%)
CBX7_C 302..334 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.