DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oxp and cbx4

DIOPT Version :10

Sequence 1:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001096327.1 Gene:cbx4 / 100124911 XenbaseID:XB-GENE-986716 Length:507 Species:Xenopus tropicalis


Alignment Length:60 Identity:22/60 - (36%)
Similarity:32/60 - (53%) Gaps:7/60 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLGKCMTLIADYEAELFQQSREKK 81
            :.||....||..:||.:||.||.|:..:..||||.||:.....|:|       .|:||::
 Frog    11 FAVESIEKKRIRKGRVEYLVKWRGWSSKYNTWEPEENILDPRLLVA-------FQNRERQ 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 19/48 (40%)
cbx4NP_001096327.1 CD_Cbx4 8..62 CDD:349292 21/57 (37%)
CBX7_C <485..506 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.