DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: icln and SPAC1610.01

Sequence 1:NP_611237.2 Gene:icln FlyBaseID:FBgn0029079 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_593485.1 Gene:SPAC1610.01 PomBaseID:SPAC1610.01 Length:217 Species:Schizosaccharomyces pombe

Alignment Length:234 Identity:48/235 (20%)
Similarity:88/235 (37%) Gaps:82/235 (35%)


  Fly    22 KLKLGDKVV-GEGTVYIAQNTLSWQ--------------------------PTELAEGISIEWKQ 59
            |::.|:|:: .:..||..:.|:.::                          ..|...|..|.::.
pombe    15 KVENGEKLLPNQEIVYFEEKTVPYKIRSDEESFPLGKLITLLVTSQSFILFDEEQNSGWKIPYET 79

  Fly    60 VSLHGISSNPRKCIYF---------MLDHKVEWNGVYGDPPQQAVNGRNGGG-SEAEVDEGNGSD 114
            ::||...|..:..:|.         :|||.:::.             |:.|. .||...|    |
pombe    80 ITLHAKQSKDKPYVYVQLEGEAIRPLLDHILKFE-------------RSSGTLHEAPSTE----D 127

  Fly   115 EHDEDDNFEDAVDEQFGEVTECWLMPEDIHTVDTMYSAMTTCQALHPDSANSDSEDSDPMQDAGG 179
            |::..|:|           .|..|...|   ||:.|.|:.|||:||||:.:||::          
pombe   128 ENEFTDDF-----------LELTLYVTD---VDSCYQALCTCQSLHPDTFSSDND---------- 168

  Fly   180 LEDEAMEEDDALTLGRN----GVQNLSLDDDEERFEDAD 214
            :|:.:|....:|....|    ..:|:.....:.||:..:
pombe   169 VENASMGNPMSLFFDPNHQWVTAENVDTSACDNRFDSPE 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
iclnNP_611237.2 Voldacs 33..189 CDD:281511 40/192 (21%)
SPAC1610.01NP_593485.1 Voldacs 53..191 CDD:281511 39/179 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.