DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: icln and CLNS1A

Sequence 1:NP_611237.2 Gene:icln FlyBaseID:FBgn0029079 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001284.1 Gene:CLNS1A HGNCID:2080 Length:237 Species:Homo sapiens

Alignment Length:167 Identity:53/168 (32%)
Similarity:77/168 (46%) Gaps:34/168 (20%)


  Fly    10 PEHGLLYTANNIKLKLGDKVVGEGTVYIAQNTLSWQPTELAEGISIEWKQVSLHGISSNPRKC-- 72
            |..|||....:.:..|..|.:|.||:|||::.|||.... ..|.|:|:..:|||.:|.:...|  
Human    12 PAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGS-GLGFSLEYPTISLHALSRDRSDCLG 75

  Fly    73 --IYFMLDHKVEWNGVYGDPPQQAVNGRNGGGSEAEVDEGNGSDEHDEDDNFEDAVDEQFGEVTE 135
              :|.|::.|.|..                 ..|...||    :|.|.||:.|        .:||
Human    76 EHLYVMVNAKFEEE-----------------SKEPVADE----EEEDSDDDVE--------PITE 111

  Fly   136 CWLMPEDIHTVDTMYSAMTTCQALHPDSANSDSEDSD 172
            ...:|.|...::.|::||..|||||||..:.||:|.|
Human   112 FRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYD 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
iclnNP_611237.2 Voldacs 33..189 CDD:281511 46/145 (32%)
CLNS1ANP_001284.1 Voldacs 35..>137 CDD:335363 40/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C271188207
eggNOG 1 0.900 E1_KOG3238
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5189
Isobase 1 0.950 0 Normalized mean entropy S6206
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1508796at2759
OrthoFinder 1 1.000 FOG0005970
OrthoInspector 1 1.000 T1072261
orthoMCL 1 0.900 OOG5_130694
Panther 1 1.100 LDO PTHR21399
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R8614
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.