DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6484 and CG33282

Sequence 1:NP_611234.1 Gene:CG6484 FlyBaseID:FBgn0034247 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:432 Identity:127/433 (29%)
Similarity:223/433 (52%) Gaps:13/433 (3%)


  Fly    24 GASIGWSSPVENMI-TVNTEYGFPISSSQFGWVSSLLTLGATVICIPIGFAIDWIGRRPTMLALI 87
            |..:||.||....| |.::...|.::.:|..|:.|:|.|.:....:.|...|:..||:..:..:.
  Fly    32 GVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLGSMLGLDSLCGNLTIAMLIERAGRKFCLYLMA 96

  Fly    88 PPYMVGWVLMLFAKNVTMLYFGRFILGMCGGAFCVTAPMYCTEITATALRGTIGSFFQLLIVSGV 152
            .||...|:|:..|.||..||..||:.|..|||..:..|::.:|:..:.:||.:.|...|.:..|:
  Fly    97 GPYACIWILIYCASNVYYLYAARFLCGFTGGAGYLVVPIFISEVADSNIRGALTSMVMLSVDLGI 161

  Fly   153 LYGYLVGAFLPLLTINILCAILPVIFAIIHFFMPESPVYLAMKGRNDDAAKALQWLRGKDADIDD 217
            |.||::..:|....:..|..||||.:.|.:..:||:..||..|.:...|..:.::.|.:.:.|.:
  Fly   162 LAGYILSTYLAYHVVPFLAIILPVAYFIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAICE 226

  Fly   218 ELKEI-LEE------SQKQIDMPQVNILSSLRRPIVLKGLGIAVLLQVFQQWTGINAVLFYSASI 275
            :..:: .||      ||:..:...::......:| .|||...:::|.:..|::|:.:.:.|.:.|
  Fly   227 QTSKVNFEELRTAVLSQQTRNATPLSYKDLTTKP-ALKGFAASIVLSLGYQFSGVFSFINYMSDI 290

  Fly   276 FEDTGSDISGSDATLIIGVTQVTSTLVAVAIIDKAGRRILLLISGVLMAVSTALMGVYFQL-KEN 339
            |:.:||.:..:.||:|||:.|:.....:..::|..|||:|:|||.:.:.:.....|.:..| |..
  Fly   291 FKASGSVVDVNTATIIIGLVQIVGVYTSTILVDIVGRRVLMLISTMGVGIGCIAFGCFTYLAKIY 355

  Fly   340 DPASMDNFGWLPISSICIFIIFFSIGFGPVPWLVMAELFSEDVKSVAGSIAGTSNWLSAFVVTLL 404
            |   :.:|.|||:..:.|.....:||...:.:||:.|||...::|:|.|::.....|..|....|
  Fly   356 D---LSDFNWLPLVLMIIICYVANIGLIGIFFLVLVELFPVKIRSLATSLSVIFLSLLVFGTLKL 417

  Fly   405 FPILKSSIGPGPTFWIFTAIAVIAFFYSLFFVPETKGKTIIE 446
            ||::....|...|.|...|.|::.|||...|:.|||||::||
  Fly   418 FPLMLHYWGISFTMWFSAASALLTFFYFWLFLQETKGKSMIE 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6484NP_611234.1 Sugar_tr 14..451 CDD:278511 127/433 (29%)
MFS 14..436 CDD:119392 120/421 (29%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 119/420 (28%)
MFS_1 53..409 CDD:284993 99/360 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97249919
eggNOG 1 0.900 E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D430696at2759
OrthoFinder 1 1.000 FOG0000041
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23500
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.