DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18A and RPL20B

DIOPT Version :9

Sequence 1:NP_523774.1 Gene:RpL18A / 36985 FlyBaseID:FBgn0010409 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_014957.2 Gene:RPL20B / 854489 SGDID:S000005839 Length:172 Species:Saccharomyces cerevisiae


Alignment Length:170 Identity:92/170 - (54%)
Similarity:125/170 - (73%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KEYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQLKKFKKTTGEIVSIKQVYETSP 72
            |||:|:||:||:|..|:..|::|||||.:.::||||:||||::|.|.||.:||||||.|:.|..|
Yeast     5 KEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKVKKASGEIVSINQINEAHP 69

  Fly    73 VKIKNFGIWLRYDSRSGTHNMYREYRDLTVGGAVTQCYRDMGARHRARAHSIQIIKVDSI-PAAK 136
            .|:||||:|:||||||||||||:|.||::...||...|:||.||||||..||.|:||..| ..|.
Yeast    70 TKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVAAVETLYQDMAARHRARFRSIHILKVAEIEKTAD 134

  Fly   137 TRRVHVKQFHDSKIKFPLVQRVHHKGNRKLFSFRKPRTYF 176
            .:|.:||||....:||||..||  :.:.|.||:::|.|::
Yeast   135 VKRQYVKQFLTKDLKFPLPHRV--QKSTKTFSYKRPSTFY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18ANP_523774.1 RPL20A 69..153 CDD:225068 47/84 (56%)
RPL20BNP_014957.2 RPL20A 66..151 CDD:225068 47/84 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346013
Domainoid 1 1.000 165 1.000 Domainoid score I824
eggNOG 1 0.900 - - E1_COG2157
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68104
Inparanoid 1 1.050 191 1.000 Inparanoid score I905
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53815
OrthoFinder 1 1.000 - - FOG0002143
OrthoInspector 1 1.000 - - otm46842
orthoMCL 1 0.900 - - OOG6_101208
Panther 1 1.100 - - LDO PTHR10052
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1116
SonicParanoid 1 1.000 - - X1428
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.